(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE189

ALDEN1_2.PE189       Location/Qualifiers
FT   CDS_pept        209767..210588
FT                   /locus_tag="Alide_0191"
FT                   /gene_family="HOG000027939" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /codon_start="1"
FT                   /product="enoyl-CoA hydratase/isomerase"
FT                   /transl_table="11"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   vei:Veis_2207 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="GI:319760927"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="GeneID:10102214"
FT                   /translation="MSSAPPVLLRREHDVLFATLNRPETRNALAPEVVAALMQAVAQAE
FT                   SDAAVRALVLRGAGGFFCAGGNVGNFQARLDADAAGEDPVAARNREFGRFMQRLAALPV
FT                   PVIAVVEGAAMGGGMGLACAADLVLATQDAKFALSETSLGIIPAQIAPFVAARLGRRAA
FT                   LRLGLFGERVAGGAAQALGLVDELAFDGAALDALLAQWLTRLCACAPGANRALKPLLRR
FT                   CGREDDGALLDDAARLFAACMRSEGAEGIAAFREKRPAAWRHEFTADAVRS"
FT                   /protein_id="YP_004124864.1"
     ATGAGCAGCG CCCCACCCGT CCTGCTGCGC CGCGAACACG ACGTGCTGTT CGCCACGCTG        60
     AACCGCCCCG AAACACGCAA CGCGCTCGCG CCCGAGGTGG TGGCTGCGCT CATGCAGGCC       120
     GTTGCCCAGG CCGAGTCCGA CGCCGCTGTG CGCGCCCTGG TGCTGCGCGG CGCGGGCGGC       180
     TTCTTCTGCG CCGGCGGCAA CGTCGGCAAC TTCCAGGCGC GGCTCGATGC CGATGCTGCC       240
     GGCGAGGACC CGGTGGCCGC GCGCAACCGC GAGTTCGGCC GCTTCATGCA ACGCCTGGCC       300
     GCGCTGCCCG TGCCGGTCAT CGCCGTGGTC GAGGGCGCGG CCATGGGCGG CGGCATGGGC       360
     CTGGCCTGCG CGGCCGACCT GGTGCTGGCC ACGCAGGACG CGAAGTTCGC GCTCAGCGAG       420
     ACCTCGCTGG GCATCATTCC GGCGCAGATC GCGCCCTTCG TCGCCGCGCG GCTGGGCCGG       480
     CGCGCGGCGC TGCGCCTGGG CCTGTTCGGC GAGCGCGTGG CCGGCGGCGC GGCGCAGGCG       540
     CTGGGCCTGG TGGACGAGCT GGCCTTTGAT GGCGCCGCGC TCGACGCCCT GCTGGCGCAG       600
     TGGCTGACGC GCCTGTGCGC CTGCGCGCCG GGCGCCAACC GCGCCCTCAA ACCCCTGCTG       660
     CGCCGCTGCG GCCGGGAAGA CGACGGCGCG CTGCTGGACG ACGCCGCGCG CCTGTTCGCC       720
     GCCTGCATGC GCAGCGAGGG CGCCGAGGGC ATTGCGGCCT TCCGCGAAAA GCGCCCGGCC       780
     GCCTGGCGCC ATGAATTCAC CGCCGATGCC GTGCGCTCCT GA                          822
//

If you have problems or comments...

PBIL Back to PBIL home page