(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE190

ALDEN1_2.PE190       Location/Qualifiers
FT   CDS_pept        210602..212596
FT                   /locus_tag="Alide_0192"
FT                   /gene_family="HOG000008989" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02786"
FT                   /codon_start="1"
FT                   /product="carbamoyl-phosphate synthase l chain ATP-binding
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Carbamoyl-phosphate synthase L chain
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; biotin carboxylase domain protein;
FT                   biotin/lipoyl attachment domain-containing protein; KEGG:
FT                   reu:Reut_B4460 carbamoyl-phosphate synthase subunit L"
FT                   /db_xref="GI:319760928"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="GeneID:10102215"
FT                   /translation="MTPCKQIRPFHTVLVANRGEIAIRIMRTARRLGYGTVAVYSEADR
FT                   DGPHVHAADRAVCIGGAAPRDSYLNIPALIDAARRAGADAVHPGYGFLAENADFADAVD
FT                   AAGLVFIGPAGAAIRAMGNKAQAKRLVLAAGMPCIPGYQGADQGDAALLAAAADVGFPV
FT                   MVKAAAGGGGRGMRLVPDAGALPQALASARSEAEVAFGSAELILERAVLAPRHVEIQVL
FT                   ADSHGHVIHLGERDCSVQRRHQKVIEEAPSPAVDAALRARMGEAAINAARAIGYIGAGT
FT                   MEFLLDRDGRFYFMEMNTRLQVEHAVTEAITGLDLVEWQLRVAAGEPLALAQDDVRLDG
FT                   HAIEVRLTAEDVPAGFLPQTGPVLRWRPPPQEGGVRVDHGLVEGGAVSPHYDSMVAKLV
FT                   AHGRTRDEARRKLLRAVGQCVLLGLPSNQGFLADCLADPAFADGGAVHTGFVQERFGER
FT                   LSERPQPPLRTLALAAFAALAGAMPHQEDGRIRPAVLGGQAARVGLAQGDARWDAQLAA
FT                   GGEGWQLAVQGGSFALRDAAWEDGARATLRVECDGITERIVVAPQGDALHCFHAGRAWS
FT                   FERVSERKRRGAEGGSGAVTAPLTGRIVDVAVRAGDAVQAGQRLLVLEAMKMEHTLTAP
FT                   LAGVVAEVCAQAGGQSAKGALLLRIEEAA"
FT                   /protein_id="YP_004124865.1"
     ATGACACCCT GCAAACAGAT CCGCCCCTTC CACACCGTGC TCGTCGCCAA CCGCGGCGAG        60
     ATCGCGATCC GCATCATGCG CACCGCGCGC CGCCTGGGTT ACGGCACCGT GGCCGTGTAT       120
     TCCGAGGCCG ACCGCGACGG CCCCCACGTG CATGCCGCCG ACCGGGCGGT GTGCATAGGC       180
     GGCGCGGCGC CGCGCGACTC CTACCTCAAC ATCCCCGCCC TGATCGATGC AGCCCGGCGC       240
     GCGGGCGCCG ACGCGGTGCA CCCGGGCTAC GGCTTCCTGG CCGAGAACGC GGACTTCGCC       300
     GACGCGGTGG ATGCCGCCGG GCTCGTGTTC ATAGGCCCCG CGGGCGCGGC GATCCGCGCC       360
     ATGGGCAACA AGGCCCAGGC CAAGCGGCTG GTGCTGGCGG CGGGCATGCC GTGCATTCCC       420
     GGCTACCAGG GCGCGGATCA GGGCGACGCG GCCCTGCTCG CCGCCGCGGC GGACGTTGGC       480
     TTTCCGGTGA TGGTGAAGGC CGCCGCCGGC GGCGGCGGGC GCGGCATGCG GCTGGTGCCG       540
     GACGCCGGCG CGCTGCCGCA GGCGCTGGCC TCGGCGCGCT CGGAGGCCGA GGTCGCCTTC       600
     GGCAGCGCCG AGCTGATCCT GGAGCGCGCC GTGCTCGCGC CGCGCCACGT GGAGATCCAG       660
     GTGCTGGCCG ACAGCCACGG CCACGTGATC CACCTGGGCG AGCGCGACTG CTCGGTGCAG       720
     CGCCGCCACC AGAAGGTGAT CGAGGAGGCG CCCTCGCCCG CCGTCGATGC CGCGCTGCGC       780
     GCACGCATGG GCGAGGCCGC CATCAACGCG GCCAGGGCCA TCGGCTACAT CGGCGCGGGC       840
     ACCATGGAGT TCCTGCTCGA CCGTGACGGG CGCTTCTATT TCATGGAGAT GAACACGCGG       900
     CTGCAGGTGG AGCACGCGGT GACCGAGGCC ATCACCGGCC TGGACCTCGT GGAATGGCAG       960
     CTGCGCGTGG CCGCGGGCGA ACCGCTCGCG CTGGCCCAGG ATGACGTGCG GCTCGATGGC      1020
     CACGCCATCG AGGTGCGGCT GACGGCCGAG GACGTACCCG CCGGCTTCCT GCCGCAGACC      1080
     GGGCCGGTGC TGCGCTGGCG CCCGCCGCCG CAGGAAGGGG GCGTGCGCGT GGACCACGGC      1140
     CTGGTCGAGG GCGGCGCGGT GTCGCCGCAC TACGACTCGA TGGTGGCCAA GCTGGTGGCG      1200
     CACGGCCGCA CGCGCGACGA GGCGCGGCGC AAGCTGCTGC GCGCCGTCGG GCAGTGCGTG      1260
     CTGCTGGGGC TGCCCAGCAA CCAGGGCTTC CTGGCCGACT GCCTGGCGGA CCCGGCGTTC      1320
     GCGGACGGCG GTGCGGTGCA CACCGGCTTC GTGCAGGAGC GCTTCGGCGA GCGCCTGTCC      1380
     GAGCGCCCGC AGCCGCCCCT GCGCACCCTG GCCCTGGCCG CCTTCGCGGC GCTGGCGGGC      1440
     GCGATGCCGC ACCAGGAGGA CGGCCGCATC CGCCCCGCCG TGCTGGGCGG GCAGGCGGCC      1500
     CGCGTCGGCC TGGCGCAGGG CGATGCGCGC TGGGACGCGC AGCTCGCGGC CGGCGGCGAA      1560
     GGCTGGCAGC TGGCGGTGCA GGGCGGCAGC TTCGCCCTGC GCGACGCCGC CTGGGAGGAC      1620
     GGCGCGCGCG CCACGCTGCG CGTGGAGTGC GACGGCATCA CCGAGCGCAT CGTCGTCGCC      1680
     CCCCAGGGTG ACGCGCTGCA CTGCTTCCAC GCCGGCCGCG CCTGGAGCTT CGAGCGCGTG      1740
     AGCGAGCGCA AGCGCCGCGG CGCCGAGGGC GGCAGCGGCG CGGTGACGGC CCCGCTCACG      1800
     GGCCGCATCG TGGACGTGGC GGTACGCGCG GGCGACGCGG TGCAGGCCGG CCAGCGCCTG      1860
     CTGGTGCTGG AGGCGATGAA GATGGAGCAC ACGCTCACCG CGCCGCTGGC CGGCGTGGTG      1920
     GCCGAGGTCT GCGCGCAGGC CGGCGGCCAG TCGGCCAAGG GCGCGCTGCT GCTGCGCATC      1980
     GAGGAGGCAG CATGA                                                       1995
//

If you have problems or comments...

PBIL Back to PBIL home page