(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE191

ALDEN1_2.PE191       Location/Qualifiers
FT   CDS_pept        212593..214407
FT                   /locus_tag="Alide_0193"
FT                   /gene_family="HOG000258966" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07287"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1446; KEGG:
FT                   reu:Reut_B4459 hypothetical protein"
FT                   /db_xref="GI:319760929"
FT                   /db_xref="InterPro:IPR010839"
FT                   /db_xref="GeneID:10102216"
FT                   /translation="MKTKTVRIGGASGFWGDSAIATPQLLQVPGLQYLVYDYLAETTMS
FT                   ILARARAKDAALGYATDFVHAAMAPNLRAICERGVRVVANAGGLNPEACRDALAAVAAA
FT                   QGLAPRIAVVTGDDLMPQFEQLRAAGLRDLHTGEAPPAALYSANAYVGARGIAQALALG
FT                   ADIVITGRCVDSAVVVGVLAHEFGWGWDDWDRIAAGTLAGHVIECGAQATGGLFTDWQQ
FT                   VPGWADMGYPVIDCAADGSFVLSKPEGTGGLIHPGAVAEQVLYEVGDPAHYLMPDVTCD
FT                   FRQVHVEALDAGHVRVAGARGRPPTGSYKANGTWRDGYQLQLMMAIRGIDAPAKARKTA
FT                   DALLARTRALMREQGFADYTETCVELLGCEALYGPNARALPTREVVLRIGARHADPKAL
FT                   AFLQRECASAGTSMGPGTRSSFAGRADVQPVIKVFSFLVPKDQVALQVVLGERVEPVAL
FT                   PAAAPAVAAAPLPAPPAAAPVVHDGIDVPLVALAWARSGDKGDDENIGVIARRPEFLPL
FT                   LRAQLTPERVKAWFAHLVQGEVERFEVPGLQALNFVLHQALAGGGVASLRSDPLGKSFA
FT                   QMLLDWPVRVPRRWADDGLLAPHHLLAD"
FT                   /protein_id="YP_004124866.1"
     ATGAAGACGA AGACGGTCCG CATCGGCGGC GCATCGGGCT TCTGGGGCGA CTCGGCCATC        60
     GCCACGCCGC AGCTGCTGCA GGTGCCGGGG CTGCAGTACC TGGTGTACGA CTACCTGGCG       120
     GAGACCACCA TGTCCATCCT GGCGCGCGCC CGCGCCAAGG ACGCGGCGCT GGGCTACGCC       180
     ACCGACTTCG TGCACGCCGC CATGGCGCCC AACTTGCGCG CCATCTGCGA GCGCGGCGTG       240
     CGCGTGGTCG CCAACGCGGG CGGCCTCAAC CCCGAGGCCT GCCGCGACGC CCTGGCTGCC       300
     GTGGCCGCCG CGCAGGGCCT GGCGCCGCGC ATCGCGGTGG TGACGGGCGA CGACCTGATG       360
     CCGCAGTTCG AGCAGCTGCG CGCCGCCGGC CTGCGCGACC TGCATACGGG CGAGGCGCCG       420
     CCCGCCGCGC TGTACTCGGC CAACGCCTAT GTCGGCGCGC GCGGCATCGC CCAGGCGCTG       480
     GCGCTGGGCG CGGACATCGT CATCACCGGC CGCTGCGTGG ACAGCGCCGT GGTGGTGGGC       540
     GTGCTGGCCC ACGAGTTTGG CTGGGGCTGG GACGACTGGG ACCGCATCGC CGCCGGAACG       600
     CTCGCGGGCC ACGTGATCGA ATGCGGCGCG CAGGCCACGG GCGGCCTGTT CACCGACTGG       660
     CAGCAGGTGC CCGGCTGGGC CGACATGGGC TACCCGGTGA TCGACTGCGC GGCGGACGGC       720
     AGCTTCGTGC TCTCCAAGCC CGAGGGCACG GGCGGCCTCA TCCACCCGGG CGCGGTGGCC       780
     GAGCAGGTGC TCTACGAGGT GGGCGACCCG GCCCACTACC TGATGCCCGA CGTGACCTGC       840
     GACTTCCGCC AGGTGCACGT CGAGGCGCTC GACGCCGGCC ACGTGCGCGT GGCCGGCGCG       900
     CGCGGCCGCC CGCCCACCGG CAGCTACAAG GCCAACGGCA CCTGGCGCGA CGGCTACCAG       960
     CTGCAGCTGA TGATGGCCAT CCGCGGCATC GACGCGCCTG CCAAGGCGCG CAAGACCGCC      1020
     GATGCGCTGC TCGCGCGCAC CCGGGCCCTG ATGCGCGAGC AGGGCTTTGC CGACTACACC      1080
     GAGACCTGCG TGGAGCTGCT CGGCTGCGAG GCGCTGTACG GCCCCAACGC CCGCGCCCTG      1140
     CCCACGCGCG AGGTGGTGCT GCGCATCGGC GCGCGCCATG CCGACCCGAA GGCGCTGGCC      1200
     TTCTTGCAGC GCGAATGCGC CTCGGCCGGC ACCTCCATGG GGCCGGGCAC GCGCTCGTCG      1260
     TTCGCCGGGC GCGCCGACGT GCAGCCGGTG ATCAAGGTCT TTTCCTTCCT GGTGCCCAAG      1320
     GACCAGGTGG CGCTGCAGGT GGTGCTGGGC GAGCGCGTGG AGCCTGTCGC CCTGCCCGCC      1380
     GCCGCGCCCG CCGTGGCCGC TGCGCCCCTG CCCGCGCCGC CCGCCGCCGC GCCCGTGGTG      1440
     CACGACGGCA TCGACGTGCC CCTGGTGGCG CTGGCCTGGG CGCGCAGCGG CGACAAGGGC      1500
     GACGACGAGA ACATCGGCGT GATCGCACGG CGGCCCGAGT TCTTGCCGCT GCTGCGCGCG      1560
     CAGCTCACGC CCGAGCGCGT GAAAGCCTGG TTCGCGCACC TGGTGCAGGG CGAGGTGGAG      1620
     CGCTTCGAGG TGCCCGGCCT GCAGGCGCTC AATTTTGTTC TGCACCAGGC GCTGGCCGGC      1680
     GGCGGCGTGG CCAGCCTGCG CTCCGACCCG CTGGGCAAGT CCTTCGCGCA GATGCTGCTG      1740
     GACTGGCCCG TGCGCGTGCC CCGGCGCTGG GCCGACGACG GCCTGCTCGC GCCTCACCAC      1800
     CTTCTTGCTG ACTGA                                                       1815
//

If you have problems or comments...

PBIL Back to PBIL home page