(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE192

ALDEN1_2.PE192       Location/Qualifiers
FT   CDS_pept        214431..215411
FT                   /locus_tag="Alide_0194"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Reut_B4458"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: reu:Reut_B4458 hypothetical protein"
FT                   /db_xref="GI:319760930"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102217"
FT                   /translation="MQSMIRRNLLAIGLGALAFAATPAWAQDNYPSKPIRVVVPYTPGG
FT                   VSDTVTRLVMQKLSDRLKTPVIVDNQGGANGQIGSAMVARSAPDGYTLLVVVAGHAINP
FT                   SLYAKMTYAPLTDLRGVSEFGAIPLLMVSSAALPPKDLKEFVAWAKANPTQATFASSGT
FT                   GSGAQLSAELFAQTAGVAMTHIPYKGMAPALPDLFSGQVAMAFDSVQTMMPQVRSGKLR
FT                   ALAMTSARRWPAAPEVPTMAEQGYPSLTGGSWIGLLAPAKVPGDIVRKLSSEMQKVIDA
FT                   PDVHAKLIEYGIDPVGGTPEQFDAFIQSEARRWADVVKKANIRLE"
FT                   /protein_id="YP_004124867.1"
     ATGCAATCGA TGATTCGCCG CAACCTGCTC GCCATTGGCC TGGGCGCGCT CGCGTTCGCC        60
     GCAACGCCCG CGTGGGCGCA GGACAACTAC CCCTCCAAGC CCATCCGCGT GGTGGTGCCG       120
     TACACGCCGG GCGGTGTGTC CGACACCGTC ACCCGCCTGG TGATGCAAAA GCTCAGCGAC       180
     CGGCTCAAGA CGCCGGTGAT CGTGGACAAC CAGGGCGGCG CCAACGGGCA GATCGGCTCG       240
     GCCATGGTGG CGCGCTCCGC GCCCGACGGC TACACGCTGC TGGTGGTGGT GGCGGGCCAT       300
     GCCATCAACC CCAGCCTGTA CGCGAAGATG ACGTACGCGC CGCTCACCGA CCTGCGCGGC       360
     GTGAGCGAGT TCGGCGCCAT TCCGTTGCTC ATGGTGTCCA GCGCCGCACT GCCGCCCAAG       420
     GACCTGAAGG AGTTCGTGGC CTGGGCCAAG GCCAACCCGA CCCAGGCCAC CTTCGCCTCC       480
     AGCGGCACGG GCTCGGGCGC GCAGCTGTCG GCCGAGCTCT TCGCCCAGAC CGCCGGCGTC       540
     GCCATGACGC ACATCCCCTA CAAGGGCATG GCGCCGGCGC TGCCGGACCT GTTCTCGGGC       600
     CAGGTGGCCA TGGCCTTCGA TTCGGTGCAG ACCATGATGC CCCAGGTGCG CTCCGGCAAG       660
     CTGCGCGCGC TGGCCATGAC CAGCGCCAGG CGCTGGCCCG CCGCGCCGGA GGTGCCGACC       720
     ATGGCCGAGC AGGGCTACCC CAGCCTCACG GGCGGCAGCT GGATCGGCCT GCTGGCGCCC       780
     GCCAAGGTGC CCGGCGACAT CGTGCGCAAG CTGTCGTCCG AGATGCAGAA GGTGATCGAC       840
     GCGCCCGACG TCCACGCCAA GCTCATCGAG TACGGCATCG ACCCGGTGGG CGGCACGCCC       900
     GAGCAGTTCG ACGCCTTCAT CCAGTCCGAG GCCAGGCGCT GGGCGGACGT GGTGAAGAAG       960
     GCCAACATCC GCCTGGAGTG A                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page