(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE193

ALDEN1_2.PE193       Location/Qualifiers
FT   CDS_pept        215419..216639
FT                   /locus_tag="Alide_0195"
FT                   /gene_family="HOG000219745" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /codon_start="1"
FT                   /product="l-carnitine dehydratase/bile acid-inducible
FT                   protein f"
FT                   /transl_table="11"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: vei:Veis_2206 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="GI:319760931"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="GeneID:10102218"
FT                   /translation="MASILEDVKVLDLTRVIAGPLCTQILADMGATVYKIEKPGEGDDT
FT                   RRMGPFLPDAATGADSNDSALYLAYNRGKRSVTLDISTPEGAALARQLASRCDVVVENY
FT                   KAGSLAKYGLDEASIRALRPDIVYCSVTGFGQDGPYAARPAYDFILQGLAGVMSTCGHP
FT                   DGAPGAGAMRTAIPITDVVTGLYATIGILGALHHRRETGQGQHVDAAMLDASVALNGHL
FT                   ALGYLMTGKVPARVGNTNPIASPSEVFDCADGQLIVAVGNNGQFQALCGVLGCPQWAQD
FT                   ARFATNARRVAHRAELRDLLAPLLCGRARAELLAAFEQAGVPSGPINDMAQVFEDPQTR
FT                   HRELAFTLPHGRGAEVPSLRNPIRYSQTPMRYRAAPMLGQDSEEVLAQVLGLGPDHLAY
FT                   LRKRAII"
FT                   /protein_id="YP_004124868.1"
     ATGGCCTCCA TCCTCGAAGA CGTGAAGGTC CTGGACCTGA CGCGCGTGAT CGCCGGCCCG        60
     CTGTGCACGC AGATCCTGGC GGACATGGGT GCCACGGTCT ACAAGATCGA GAAGCCCGGC       120
     GAGGGCGACG ACACGCGGCG CATGGGCCCC TTCCTGCCCG ACGCGGCGAC GGGCGCCGAC       180
     AGCAACGACT CGGCGCTGTA CCTGGCCTAC AACCGGGGCA AGCGCTCCGT CACTCTGGAC       240
     ATCTCCACGC CCGAGGGCGC GGCGCTGGCG CGGCAGCTCG CGTCGCGCTG CGACGTGGTG       300
     GTGGAGAACT ACAAGGCCGG CTCGCTGGCC AAGTACGGCC TGGACGAGGC TAGCATCCGC       360
     GCGCTGCGGC CCGACATCGT GTACTGCTCG GTCACCGGCT TCGGCCAGGA CGGGCCCTAC       420
     GCGGCGCGGC CGGCCTACGA CTTCATCCTG CAGGGCCTGG CCGGCGTGAT GAGCACCTGC       480
     GGCCATCCCG ACGGCGCGCC GGGCGCGGGC GCGATGCGCA CCGCGATCCC CATCACCGAC       540
     GTGGTCACGG GCTTGTACGC CACCATCGGC ATCCTGGGCG CGCTGCACCA CCGGCGCGAG       600
     ACGGGCCAGG GCCAGCACGT GGACGCGGCG ATGCTGGACG CGTCCGTGGC GCTCAACGGC       660
     CACCTCGCGC TCGGCTACCT CATGACGGGC AAGGTGCCCG CGCGCGTGGG CAACACCAAC       720
     CCGATCGCCT CGCCCTCCGA GGTGTTCGAC TGCGCCGACG GGCAGCTCAT CGTCGCCGTC       780
     GGCAACAACG GGCAGTTCCA GGCCCTGTGC GGCGTGCTGG GCTGCCCGCA GTGGGCTCAG       840
     GACGCGCGCT TCGCCACCAA CGCCCGGCGC GTGGCCCACC GTGCCGAGCT GCGCGACCTG       900
     CTCGCGCCGC TGCTGTGCGG GCGCGCGCGC GCCGAGCTGC TGGCCGCCTT CGAGCAGGCC       960
     GGCGTGCCCA GCGGGCCGAT CAACGACATG GCGCAGGTCT TCGAGGACCC GCAGACGCGC      1020
     CACCGCGAAC TCGCCTTCAC GCTGCCCCAC GGGCGCGGCG CCGAGGTGCC CAGCCTGCGC      1080
     AACCCGATCC GCTACTCGCA AACGCCCATG CGCTACCGTG CGGCGCCGAT GCTGGGGCAG      1140
     GACAGCGAGG AGGTCCTGGC GCAAGTGCTG GGTCTGGGCC CGGACCATCT CGCCTATCTG      1200
     CGAAAGCGCG CCATTATTTA G                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page