(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE194

ALDEN1_2.PE194       Location/Qualifiers
FT   CDS_pept        complement(216685..217602)
FT                   /locus_tag="Alide_0196"
FT                   /gene_family="HOG000233524" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="lysr substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: dia:Dtpsy_0150 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="GI:319760932"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:10102219"
FT                   /translation="MAMHFDLVDLRLMVHIADANSMTRGAELSFISLPAASTRIKNLEE
FT                   SIGTKLLYRTSQGVTLTPPGQAFVTHARMVLGQIEHLRGDMQEYVRGIKGHVRVFANTT
FT                   SLGEFLPPVLRHFLRRNPDVNIDLRERLSHDIVRAVTEGQTDIGIVAGLVRTENLETLP
FT                   YRRDRLVLVVPRGHPLDGQMQIDFSDTLELDYVGLHESSAIHAFLRQASDQLHRPIKQR
FT                   IQVGNFETACRMIEAGVGVGVLPESAASRHAHAMDIAIVPLSDAWSVREMQICVRSLEA
FT                   LPSFAQELVELLVADAQGRLQLDR"
FT                   /protein_id="YP_004124869.1"
     atggccatgc atttcgatct tgtggacctg cgcctgatgg tgcacatcgc cgacgccaac        60
     agcatgacgc gcggcgccga gctgtccttt atctccctgc ccgccgccag cacgcgcatc       120
     aagaacctgg aggagagcat aggcaccaag ctgctttacc gcacgagcca gggcgtgacg       180
     ctgacgccgc cgggccaggc cttcgtgacg cacgcgcgca tggtgctggg ccagatcgag       240
     cacctgcgcg gcgacatgca ggagtatgtg cgcggcatca agggccacgt gcgcgtgttc       300
     gccaacacca cgtcgctcgg cgagttcctg ccgccggtgc tgcgccactt cctgcgccgc       360
     aaccccgacg tgaacatcga cctgcgcgag cgcctgtcgc acgacatcgt gcgcgcggtg       420
     accgaggggc agaccgacat cggcatcgtc gccggcctgg tgcgcaccga gaacctggag       480
     accctgccct accggcgcga ccggctcgtg ctcgtggtgc cgcgcggcca cccgctcgac       540
     ggccagatgc agatcgactt cagcgacacg ctggagctgg actacgtggg cctgcacgag       600
     tcgagcgcca tccatgcctt cctgcgccag gccagcgacc agctgcaccg cccgatcaag       660
     cagcgcatcc aggtgggcaa cttcgagacg gcctgccgca tgatcgaggc cggcgtgggc       720
     gtgggcgtgc tgcccgagtc ggcggcgagc cgccacgcgc acgcgatgga catcgccatc       780
     gtgccgctgt cggacgcgtg gtcggtgcgc gagatgcaga tctgcgtgcg cagcctggag       840
     gccctgccct cgttcgcgca ggagctcgtg gagctgctcg tggccgacgc gcaagggcgg       900
     ctgcagctcg atcgttag                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page