(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE195

ALDEN1_2.PE195       Location/Qualifiers
FT   CDS_pept        217712..218989
FT                   /locus_tag="Alide_0197"
FT                   /gene_family="HOG000219745" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /codon_start="1"
FT                   /product="l-carnitine dehydratase/bile acid-inducible
FT                   protein f"
FT                   /transl_table="11"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: dia:Dtpsy_0151 L-carnitine
FT                   dehydratase/bile acid-inducible protein F"
FT                   /db_xref="GI:319760933"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="GeneID:10102220"
FT                   /translation="MTAADTSSSAATGALSHLRVLDLSRVLAGPWCTQNLADMGADVIK
FT                   IEKPGDGDDTRHWGPPFFPDAEGKPTSHACYFAACNRNKRSVTVDMATPEGQQLIRELA
FT                   MQSDVVVENFKTGGLKRYGLDYASLSALNPRLIYCSVTGFGHTGPYAPRAGYDLLIQAM
FT                   SGLMSITGHADGEPGGGPMRVGVAVIDLFTGMYATTAILGALEARHRTGRGQHIDMALL
FT                   DVAMAILANQGAGFLNAGNVPKRQGNTHPSVVPYQDFPTQDGNMLLAIGNDGQFARFCE
FT                   VAGVDWASDERFTQNAGRVIHRDTLIPMMAALTRTRSTAEWVRLLEDKAVPCGPINHIG
FT                   QAFDDEQVRARSLRIVQERYPGAQPPAGETVNRVVTTASPLRLSDTPVTLRHAPPALGQ
FT                   HTDEVLRERLGLDAARLQELRAKGVL"
FT                   /protein_id="YP_004124870.1"
     ATGACCGCTG CCGACACCTC CTCCAGCGCC GCCACCGGCG CCCTGAGCCA CCTGCGTGTG        60
     CTCGACCTCT CGCGCGTGCT CGCCGGCCCC TGGTGCACCC AGAACCTGGC CGACATGGGC       120
     GCCGACGTGA TCAAGATCGA AAAGCCCGGA GACGGCGACG ACACGCGCCA CTGGGGCCCG       180
     CCCTTCTTCC CCGACGCCGA GGGCAAGCCG ACCAGCCACG CCTGCTACTT CGCCGCCTGC       240
     AACCGCAACA AGCGCTCCGT CACCGTGGAC ATGGCCACGC CCGAGGGCCA GCAGCTGATC       300
     CGCGAACTGG CCATGCAAAG CGACGTGGTG GTGGAGAACT TCAAGACCGG AGGCCTGAAG       360
     CGCTACGGCC TGGACTATGC CAGCCTGTCG GCGCTGAACC CGCGCCTGAT CTACTGCTCG       420
     GTCACCGGCT TCGGCCACAC CGGGCCGTAT GCGCCGCGCG CCGGCTACGA CCTGCTGATC       480
     CAGGCCATGA GCGGCCTGAT GAGCATCACC GGCCACGCCG ACGGCGAGCC CGGCGGCGGC       540
     CCCATGCGCG TGGGCGTGGC GGTGATCGAC CTGTTCACCG GCATGTACGC CACCACGGCC       600
     ATCCTGGGCG CGCTGGAGGC GCGCCACCGC ACGGGCCGCG GCCAGCACAT CGACATGGCG       660
     CTGCTGGACG TGGCCATGGC CATCCTGGCC AACCAGGGCG CGGGCTTTCT CAACGCCGGC       720
     AACGTCCCCA AGCGCCAGGG CAACACCCAC CCCAGCGTCG TGCCCTACCA GGACTTCCCC       780
     ACGCAGGACG GCAACATGCT GCTGGCGATC GGCAACGACG GGCAGTTCGC GCGCTTCTGC       840
     GAGGTCGCGG GCGTGGACTG GGCCAGCGAC GAGCGCTTCA CGCAGAACGC CGGCCGCGTC       900
     ATCCACCGCG ACACGCTGAT CCCGATGATG GCCGCCCTCA CGCGCACGCG CAGCACCGCC       960
     GAATGGGTGC GGCTGCTGGA GGACAAGGCC GTGCCCTGCG GGCCCATCAA CCACATCGGC      1020
     CAGGCCTTCG ACGACGAACA GGTGCGTGCG CGCAGCCTGC GCATTGTGCA GGAACGCTAC      1080
     CCGGGCGCCC AGCCCCCCGC CGGAGAGACC GTGAACCGCG TGGTGACCAC GGCCAGTCCG      1140
     TTGCGCCTGT CCGATACCCC CGTGACCCTG CGCCACGCGC CGCCGGCCCT GGGCCAGCAC      1200
     ACCGACGAGG TGCTGCGCGA GCGCCTGGGT CTGGATGCGG CGCGGCTGCA GGAGCTGCGC      1260
     GCCAAGGGCG TGCTTTGA                                                    1278
//

If you have problems or comments...

PBIL Back to PBIL home page