(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE196

ALDEN1_2.PE196       Location/Qualifiers
FT   CDS_pept        complement(219041..219940)
FT                   /locus_tag="Alide_0198"
FT                   /gene_family="HOG000233524" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="lysr substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: ctt:CtCNB1_0218 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="GI:319760934"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:10102221"
FT                   /translation="MQFELKDLRLFLLVAQRGSLSRAAEQLHLSLAATSARVKALEERV
FT                   GMPLLIREARGVRLSPPGEAFLFHARAILQQARQLQAELQEYGAGLRGHLRVFANTTAV
FT                   TDFMPDILAAYLTAHPHISVDLEERPNARIAEDIREGRADLGIVAGEVDTHGLQSLHFS
FT                   TDRLVLVTPPTPAWRAIQEIPFAQVLHENFVGMHRTSTLQTFLDGMGQQLGHTLKLRIQ
FT                   LASFDAMCRMVAAGVGIAVVPESGAMRYAQGAHVHQVQLMDSWAVRPRYMLVRTLQGLP
FT                   AHAQALMAAVQAHHAARA"
FT                   /protein_id="YP_004124871.1"
     atgcaattcg aactcaagga tctgcgtctt tttttactcg tggcccagcg cggcagcctt        60
     tcccgtgcag cggagcaact gcacctgtcc ctggcggcga ccagcgcacg cgtcaaggcg       120
     ctggaggagc gggtgggcat gcctttgctg atacgagagg ctcggggcgt gcgtctgtca       180
     ccgcccgggg aggccttcct gtttcatgcg cgagccatcc tgcagcaggc gcgccagttg       240
     caggccgagc tgcaggagta cggcgcgggc ctgcgcgggc atctgcgcgt gttcgccaac       300
     accacggcgg tcacggactt catgcccgac atcctggcgg cgtacctgac ggcgcacccg       360
     cacatcagcg tggacctgga ggagcgcccc aacgcccgta tcgccgagga catccgcgaa       420
     ggccgggcgg acctgggcat cgtggccggc gaggtggaca cccacgggct gcaaagcctg       480
     catttcagca ccgaccggct ggtgctggtc acgccgccca ccccggcctg gcgcgctatc       540
     caggaaattc cgttcgccca ggtgctgcac gagaatttcg tgggcatgca ccgcaccagt       600
     acgctgcaga cctttctgga cggcatggga cagcagctgg ggcatacgct caagctgcgc       660
     atccagctgg ccagcttcga cgccatgtgc cgcatggtgg ccgccggcgt cggcattgcc       720
     gtggtgcccg aaagcggcgc catgcgctac gcccagggag cgcatgtgca ccaggtccag       780
     ctgatggaca gctgggccgt gcgtccgcgc tacatgctgg tgcgcacgct gcaggggctg       840
     cccgcgcatg cacaggcgct gatggcggcc gtgcaggccc accacgctgc gcgcgcgtga       900
//

If you have problems or comments...

PBIL Back to PBIL home page