(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE198

ALDEN1_2.PE198       Location/Qualifiers
FT   CDS_pept        221223..222413
FT                   /locus_tag="Alide_0200"
FT                   /gene_family="HOG000219745" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /codon_start="1"
FT                   /product="l-carnitine dehydratase/bile acid-inducible
FT                   protein f"
FT                   /transl_table="11"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: ajs:Ajs_0117 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="GI:319760936"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="GeneID:10102223"
FT                   /translation="MPRPLDGITVVSLEHAVAAPFCTRQLADLGARVIKVERPGSGDFA
FT                   RGYDQRVRGQSSHFTWINRSKESLALDVKHPQAKAALMQLLKTADVLVQNLAPGAAARM
FT                   GLSHEALKEHNPRLIVCDISGYGADGPYRDKKAYDLLIQSEAGFLSVTGTPETPSKSGI
FT                   SVADIAAGMYAYSNILSALLLRARTGEGSHIDVSMLEAMGEWMGYPMYYAYQDAPPPPR
FT                   TGASHASIYPYGPFTAGDGGTVMLGLQNEREWKTFCDAVLQRPEVATDARFCSNAQRNQ
FT                   HRSELQALILEVFAALTAAQVVERLDAAAIANARVNDMAGLWAHPQLKARQRWRSVGTP
FT                   AGEVPALLPPGVNSAFDYRMDAVPAVGQHTAAILAALGWTDGQIDEVITPSPSGEG"
FT                   /protein_id="YP_004124873.1"
     ATGCCCCGCC CCCTCGACGG CATCACCGTC GTCTCGCTCG AACACGCCGT CGCCGCCCCG        60
     TTCTGCACGC GCCAGCTGGC CGACCTGGGC GCGCGCGTCA TCAAGGTGGA GCGCCCCGGC       120
     AGCGGCGACT TCGCGCGCGG CTACGACCAG CGCGTGCGCG GCCAGTCGTC GCACTTCACC       180
     TGGATCAACC GCAGCAAAGA GAGCCTGGCG CTGGACGTGA AGCACCCCCA GGCCAAGGCC       240
     GCGCTGATGC AGCTCCTGAA GACCGCCGAC GTGCTGGTGC AGAACCTGGC GCCCGGCGCC       300
     GCCGCGCGCA TGGGCCTGTC GCATGAGGCG TTGAAGGAGC ACAACCCGCG CCTGATCGTG       360
     TGCGACATCA GCGGCTACGG CGCCGACGGA CCGTACCGCG ACAAGAAGGC CTACGACCTG       420
     CTGATCCAGA GCGAGGCGGG GTTCCTCTCC GTCACCGGCA CGCCCGAGAC GCCCTCCAAG       480
     TCCGGCATCT CGGTGGCCGA CATCGCCGCC GGCATGTACG CCTACAGCAA CATCCTGTCG       540
     GCCCTGCTGC TGCGCGCCAG GACGGGCGAG GGCAGCCACA TCGACGTGTC CATGCTCGAA       600
     GCCATGGGCG AGTGGATGGG CTACCCGATG TACTACGCTT ATCAAGACGC GCCGCCGCCG       660
     CCGCGCACCG GCGCCAGCCA CGCCAGCATC TACCCCTACG GGCCGTTCAC GGCCGGCGAC       720
     GGCGGCACCG TGATGCTGGG CCTGCAAAAC GAGCGCGAGT GGAAGACCTT CTGCGACGCC       780
     GTGCTGCAGC GCCCCGAGGT GGCCACCGAC GCGCGCTTCT GTTCCAACGC CCAGCGCAAC       840
     CAGCACCGCA GTGAGCTGCA GGCGCTGATC CTGGAAGTCT TCGCCGCACT CACGGCGGCA       900
     CAGGTCGTGG AGCGCCTGGA TGCGGCGGCA ATAGCCAACG CGCGCGTCAA CGACATGGCC       960
     GGCCTGTGGG CGCACCCGCA GCTCAAGGCG CGCCAGCGCT GGCGCAGCGT GGGCACGCCC      1020
     GCGGGCGAGG TGCCGGCCCT GCTGCCGCCG GGCGTGAACA GCGCGTTCGA TTACCGCATG      1080
     GATGCCGTGC CCGCCGTGGG CCAGCACACC GCCGCCATCC TGGCCGCGCT GGGCTGGACG      1140
     GACGGGCAGA TCGACGAAGT CATCACGCCC TCCCCCTCTG GGGAAGGGTA G               1191
//

If you have problems or comments...

PBIL Back to PBIL home page