(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE2

ALDEN1_2.PE2         Location/Qualifiers
FT   CDS_pept        1754..2860
FT                   /locus_tag="Alide_0002"
FT                   /gene_family="HOG000071791" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /codon_start="1"
FT                   /EC_number="2.7.7.7"
FT                   /transl_table="11"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: dia:Dtpsy_0002 DNA
FT                   polymerase III, beta subunit; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="GI:319760740"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0008408"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="GeneID:10102025"
FT                   /translation="MIVLKATQDKVLAVLQSVSGIVERRHTLPILANVLIRKTGNALQF
FT                   TTSDLEIQIRTTAELGGDTGDFTTTVGARKLIDILKTMPADQTVSLENSQTKLILKGGK
FT                   SRFTLQTLPAEDFPLVQEAASFGPAFSVPQKTLKTLLSQVSFAMAVQDIRYYLNGILFV
FT                   AEGKTLSLVATDGHRLAFASSELDMEVPKQEVILPRKTVLELQRLLSDADGAIEMRFAN
FT                   NQAKFGFGGMEFVTKLVEGKFPDYNRVIPRNHHNVITLGRAPLLASLQRTAIMTSEKFK
FT                   GVRLNIEPGSLRVASSNAEQEEAVDELDIDYGGDSIEIGFNVTYLIDVLANMGQDMVRM
FT                   ELADGNSSVVFGIPDNTHFKYVVMPMRI"
FT                   /product="DNA polymerase iii, beta subunit"
FT                   /protein_id="YP_004124677.1"
     ATGATTGTCC TGAAGGCAAC ACAAGACAAG GTTCTCGCCG TCCTGCAATC CGTGTCCGGC        60
     ATCGTCGAGC GCCGGCATAC CCTGCCCATA CTGGCCAACG TGCTGATCCG CAAGACCGGC       120
     AATGCGCTGC AGTTCACCAC CAGCGACCTG GAGATCCAGA TCCGCACCAC GGCCGAGCTG       180
     GGTGGCGACA CGGGCGATTT CACGACCACG GTGGGGGCGC GCAAGCTCAT CGACATCCTG       240
     AAGACCATGC CCGCCGACCA GACGGTGAGC CTGGAGAACA GCCAGACCAA GCTGATCCTC       300
     AAGGGCGGCA AGAGCCGCTT CACGCTGCAG ACCCTGCCGG CCGAGGACTT CCCGCTGGTG       360
     CAGGAGGCCG CCAGCTTCGG CCCCGCGTTC AGCGTGCCTC AAAAGACGCT CAAGACCCTG       420
     CTGTCCCAGG TGTCGTTCGC CATGGCGGTG CAGGACATCC GCTACTACCT GAACGGCATC       480
     CTGTTCGTGG CCGAGGGCAA GACGCTCTCG CTGGTGGCCA CCGACGGCCA CCGCCTGGCC       540
     TTCGCGAGCA GCGAGCTCGA CATGGAGGTG CCCAAGCAGG AGGTGATCCT GCCGCGCAAG       600
     ACGGTGCTGG AGCTGCAGCG CCTGCTGTCC GACGCCGACG GCGCCATCGA GATGCGCTTC       660
     GCCAACAACC AGGCCAAGTT CGGCTTCGGC GGCATGGAGT TCGTCACCAA GCTGGTCGAG       720
     GGCAAGTTCC CCGACTACAA CCGCGTCATT CCGCGCAACC ACCACAACGT CATCACCCTG       780
     GGCCGCGCGC CGCTCTTGGC CAGCCTGCAG CGCACGGCCA TCATGACCAG CGAGAAGTTC       840
     AAGGGCGTGC GCCTGAACAT CGAGCCCGGC AGCCTGCGCG TGGCGTCCAG CAACGCCGAG       900
     CAGGAGGAGG CCGTGGACGA GCTCGACATC GACTACGGCG GCGACAGCAT CGAGATCGGC       960
     TTCAACGTGA CCTACCTCAT CGACGTGCTG GCCAACATGG GCCAGGACAT GGTGAGGATG      1020
     GAACTGGCCG ACGGCAACAG CTCGGTCGTC TTCGGCATCC CCGACAACAC GCACTTCAAG      1080
     TACGTCGTGA TGCCCATGCG CATTTGA                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page