(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE200

ALDEN1_2.PE200       Location/Qualifiers
FT   CDS_pept        223917..224366
FT                   /locus_tag="Alide_0202"
FT                   /gene_family="HOG000218246" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05232"
FT                   /codon_start="1"
FT                   /product="transmembrane pair domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transmembrane pair domain-containing protein;
FT                   KEGG: dia:Dtpsy_0156 transmembrane pair domain protein"
FT                   /db_xref="GI:319760938"
FT                   /db_xref="InterPro:IPR007896"
FT                   /db_xref="GeneID:10102225"
FT                   /translation="MNATRTARGLQGPWRRLVFVSLYELIAILASSLLFMAIGQGAGAS
FT                   GAMAVVASTLAIVWNVTFNHLFEKWEARQSVKGRSAMRRVVHAMGFEGGLALALIPLMA
FT                   WWFGVSLWEATLMEAGLLLFFLVYTYLFNWAFDRIFGLPASAQPA"
FT                   /protein_id="YP_004124875.1"
     ATGAATGCAA CGCGTACGGC CCGTGGCCTG CAGGGCCCCT GGCGCCGCCT GGTCTTCGTC        60
     TCCCTGTACG AGCTGATCGC CATCCTTGCC TCCAGCCTGC TGTTCATGGC CATAGGCCAG       120
     GGTGCGGGCG CATCGGGCGC CATGGCCGTG GTGGCCTCGA CGCTGGCCAT CGTCTGGAAC       180
     GTCACCTTCA ACCACCTGTT CGAGAAATGG GAGGCACGCC AGAGCGTCAA GGGCCGCTCG       240
     GCGATGCGCC GTGTGGTGCA TGCCATGGGC TTCGAGGGCG GCCTGGCATT GGCGCTCATT       300
     CCTCTCATGG CCTGGTGGTT CGGCGTGAGC CTGTGGGAGG CCACGCTGAT GGAAGCGGGG       360
     CTGCTGCTGT TCTTCCTCGT CTACACCTAC CTCTTCAACT GGGCCTTCGA CCGCATCTTC       420
     GGCCTGCCGG CGTCGGCACA GCCTGCTTGA                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page