(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE201

ALDEN1_2.PE201       Location/Qualifiers
FT   CDS_pept        225477..228212
FT                   /locus_tag="Alide_0204"
FT                   /gene_family="HOG000251409" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02082"
FT                   /codon_start="1"
FT                   /EC_number="2.1.1.13"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: methionine synthase; KEGG: dac:Daci_0232
FT                   methionine synthase; PFAM: dihydropteroate synthase DHPS;
FT                   Methionine synthase B12-binding module cap domain protein;
FT                   cobalamin B12-binding domain protein; Vitamin B12 dependent
FT                   methionine synthase activation region"
FT                   /db_xref="GI:319760939"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0008705"
FT                   /db_xref="GO:0031419"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="GeneID:10102227"
FT                   /translation="MSAVTPPPMKLSGLEPVFIGEGSLFVNVGERTNVTGSKAFARMIL
FT                   GEQYEQALSVARQQVENGAQVIDVNMDEAMLDSKAAMVRFLNLIASEPDIAKVPVMVDS
FT                   SKWEVIEAGLRCLQGKGIVNSISMKEGVEEFKRQAKLIKRYGAAAVVMAFDEQGQADTF
FT                   ARKTEICQRAYRILVDEVGFAPEDIIFDPNIFAIATGIEEHANYAVDFIEATRWIKQHL
FT                   PGAKVSGGVSNVSFSFRGNDPVREAIHTVFLYHAIKAGMDMGIVNAGMVGVYDDLDPEL
FT                   RARVEDVVLNRRPDAAERLLEIAEAAKGAAKDDSKKLEWRGTPDNPRPVGERLAHALVH
FT                   GITDFIVADTEEAYQQIVVQGGGRPLHVIEGPLMDGMNIVGDLFGAGKMFLPQVVKSAR
FT                   VMKQAVAHLIPYIEEEKRQQEAAGLDVSSKGKIVVATVKGDVHDIGKNIVTVVLQCNNF
FT                   EVINMGVMVPCHEILARAKAEGADIVGLSGLITPSLEEMQYVAGEMHKDDYFRIKKIPL
FT                   LIGGATCSRVHTAVKIAPQYEGPVVYVPDASRSVSVAQSLLGEGKDAYLAEVQADYDHV
FT                   RELHAKKKKVPLWPIEKARANAARLDYVPVVPRALGRRVFRNFDLAEIAKYLDWGPFFQ
FT                   TWDLAGAFPAILDDDVVGEEARKVYADGQAMLKKIIEGRWLQANGVIGLFPANRVGDDI
FT                   EFYTDETRTQVLMTWYGLRQQTEKQVDAEGRLRPSRSLADFVAPKESGIADYAGMFAVT
FT                   AGIGAEKKEKEFLDALDDYSNILFKGLADRLAEAFAECLHERVRKDLWGYGADESLSNE
FT                   DLIKEKYQGIRPAPGYPACPDHTAKIALFDTLQAREIGMDLTESMAMFPASSVSGFYLA
FT                   HPQATYFVVGQIGDDQVQDMAARRGMDVEELRRRLAPNLG"
FT                   /product="methionine synthase"
FT                   /protein_id="YP_004124876.1"
     ATGTCCGCCG TAACCCCGCC CCCCATGAAG CTGTCCGGCC TGGAGCCGGT TTTTATTGGC        60
     GAAGGCAGCC TGTTCGTCAA CGTCGGCGAG CGCACCAACG TCACGGGCTC CAAGGCCTTC       120
     GCGCGCATGA TCCTGGGCGA GCAGTACGAG CAGGCCCTGT CGGTGGCGCG CCAGCAGGTG       180
     GAGAACGGCG CCCAGGTCAT CGATGTGAAC ATGGACGAGG CCATGCTCGA CAGCAAGGCC       240
     GCCATGGTGC GCTTCCTGAA CCTCATCGCG TCCGAGCCCG ACATCGCCAA GGTGCCGGTG       300
     ATGGTGGACA GCTCCAAGTG GGAGGTCATC GAGGCCGGCC TGCGCTGCCT GCAGGGCAAG       360
     GGCATCGTCA ACTCCATCAG CATGAAGGAG GGCGTGGAGG AGTTCAAGCG CCAGGCCAAG       420
     CTCATCAAGC GCTACGGCGC CGCCGCCGTG GTGATGGCGT TTGACGAGCA GGGCCAGGCC       480
     GACACCTTCG CGCGCAAGAC CGAGATCTGC CAGCGCGCCT ACCGCATCCT GGTGGATGAG       540
     GTGGGCTTCG CGCCCGAGGA CATCATCTTC GACCCCAACA TCTTCGCCAT CGCCACGGGC       600
     ATCGAGGAGC ACGCCAACTA CGCCGTGGAC TTCATCGAGG CCACGCGCTG GATCAAGCAG       660
     CACCTGCCGG GCGCCAAGGT GAGCGGCGGC GTGTCCAACG TCTCCTTCAG CTTCCGCGGC       720
     AACGACCCCG TGCGCGAGGC CATCCACACC GTGTTCCTGT ACCACGCCAT CAAGGCCGGC       780
     ATGGACATGG GCATCGTCAA CGCCGGCATG GTCGGCGTCT ACGACGACCT CGACCCCGAG       840
     CTGCGCGCGC GCGTGGAGGA CGTGGTGCTC AACCGCCGCC CCGACGCGGC CGAGCGCTTG       900
     CTGGAGATCG CCGAGGCCGC CAAGGGCGCG GCCAAGGACG ACAGCAAGAA GCTCGAATGG       960
     CGCGGCACGC CTGACAACCC CCGCCCCGTG GGCGAGCGCC TGGCGCATGC GCTGGTGCAC      1020
     GGCATCACCG ACTTCATCGT CGCAGATACC GAGGAGGCCT ACCAGCAGAT CGTGGTGCAG      1080
     GGGGGCGGCC GCCCGCTGCA CGTCATCGAA GGCCCGCTCA TGGACGGCAT GAACATCGTC      1140
     GGCGACCTGT TCGGCGCCGG CAAGATGTTC CTGCCCCAGG TGGTGAAGAG CGCGCGCGTG      1200
     ATGAAGCAGG CCGTGGCGCA CCTGATTCCC TACATCGAGG AAGAAAAGCG CCAGCAGGAG      1260
     GCGGCGGGCC TGGACGTGTC GAGCAAGGGC AAGATCGTCG TCGCCACCGT CAAGGGCGAC      1320
     GTGCACGACA TCGGCAAGAA CATCGTCACC GTGGTCCTGC AGTGCAACAA CTTCGAGGTC      1380
     ATCAACATGG GCGTGATGGT GCCCTGCCAC GAGATCCTGG CGCGCGCCAA GGCCGAGGGC      1440
     GCGGACATCG TCGGCCTGTC GGGCCTCATC ACGCCGAGCC TGGAGGAAAT GCAGTACGTC      1500
     GCCGGCGAAA TGCACAAGGA CGACTATTTC CGTATCAAGA AGATCCCGCT GCTCATCGGC      1560
     GGCGCCACCT GCTCGCGCGT GCACACCGCC GTCAAGATCG CGCCGCAGTA CGAAGGCCCC      1620
     GTGGTCTACG TGCCCGACGC CTCGCGCAGC GTGAGCGTGG CGCAGAGCCT GCTGGGCGAG      1680
     GGTAAGGACG CCTACCTGGC CGAGGTGCAG GCCGACTACG ACCACGTGCG CGAGCTGCAC      1740
     GCCAAAAAGA AGAAGGTGCC GCTGTGGCCC ATCGAAAAGG CGCGCGCCAA CGCCGCGCGG      1800
     CTGGACTATG TCCCGGTCGT GCCGCGCGCG CTGGGCCGCC GCGTGTTCCG CAACTTCGAC      1860
     CTGGCCGAGA TCGCCAAGTA CCTGGACTGG GGCCCGTTCT TCCAGACCTG GGATTTGGCG      1920
     GGGGCGTTCC CGGCCATCCT CGACGACGAT GTCGTGGGTG AGGAGGCGCG CAAGGTCTAC      1980
     GCCGACGGCC AGGCCATGCT CAAGAAGATC ATCGAGGGCC GCTGGCTCCA GGCCAACGGC      2040
     GTGATCGGCC TGTTCCCCGC CAACAGAGTG GGCGACGACA TCGAGTTCTA CACCGACGAG      2100
     ACGCGCACCC AGGTCCTCAT GACCTGGTAC GGCCTGCGCC AGCAGACCGA AAAGCAGGTG      2160
     GACGCCGAAG GCCGGCTGCG CCCCAGCCGG AGCCTGGCCG ACTTCGTCGC GCCCAAGGAG      2220
     TCGGGCATTG CCGACTACGC CGGCATGTTC GCCGTCACGG CGGGCATAGG CGCAGAGAAG      2280
     AAGGAAAAAG AGTTCCTCGA CGCGCTCGAC GACTACAGCA ACATCCTCTT CAAGGGCCTG      2340
     GCCGACCGCC TGGCCGAAGC CTTCGCCGAA TGCCTGCACG AGCGCGTGCG CAAGGACCTG      2400
     TGGGGCTATG GCGCAGACGA GAGCCTCAGC AACGAAGACC TCATCAAGGA AAAATACCAG      2460
     GGCATACGCC CCGCGCCCGG CTACCCGGCC TGCCCAGACC ACACGGCCAA GATCGCCCTG      2520
     TTCGACACCC TGCAGGCGCG CGAGATCGGC ATGGACTTGA CGGAGAGCAT GGCCATGTTC      2580
     CCGGCGTCCA GCGTCAGCGG CTTCTACCTG GCGCACCCGC AGGCGACCTA CTTCGTGGTG      2640
     GGCCAGATCG GCGACGACCA GGTGCAGGAC ATGGCCGCGC GCCGCGGCAT GGACGTCGAG      2700
     GAACTGCGCC GCAGGCTGGC GCCTAACCTG GGATAG                                2736
//

If you have problems or comments...

PBIL Back to PBIL home page