(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE203

ALDEN1_2.PE203       Location/Qualifiers
FT   CDS_pept        231466..232395
FT                   /locus_tag="Alide_0206"
FT                   /gene_family="HOG000022412" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03639"
FT                   /codon_start="1"
FT                   /product="crispr-associated protein cas1"
FT                   /transl_table="11"
FT                   /note="KEGG: vei:Veis_1231 CRISPR-associated Cas1 family
FT                   protein; TIGRFAM: CRISPR-associated protein Cas1; PFAM:
FT                   protein of unknown function DUF48"
FT                   /db_xref="GI:319760941"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019855"
FT                   /db_xref="GeneID:10102229"
FT                   /translation="MIGRIVEIADDRRHLFVNRGFLVVRDTEGERKELGQVPLDDIAAV
FT                   IANAHGLTYTNNLLVALAERGAPFVLCGPNHNAMGMLLPIDGHHVQAKRIEAQIAASLP
FT                   VHKRLWAAVVKSKLEQQAAALEAAAAPTAPLLALVSKVKSGDPENIEGQGARRYWGLLF
FT                   GNTFRRDQNGDGVNALLNYGYTILRSATARAVVAAGLHPSIGLHHSNDSNAMRLVDDLM
FT                   EPFRPVVDLKVWQLLAQGEAHVTPETKRALVRVLYDDMQTSVGVTPVMVCMQKLAISLA
FT                   QVYLGERTKLDLPLQGLPLALAGSSESD"
FT                   /protein_id="YP_004124878.1"
     ATGATCGGTC GTATCGTCGA AATCGCAGAC GACCGGCGGC ATCTCTTCGT CAATCGCGGC        60
     TTCCTGGTCG TGCGTGACAC CGAAGGTGAA CGCAAGGAAC TGGGTCAGGT GCCACTGGAC       120
     GACATTGCTG CTGTCATCGC CAACGCCCAC GGCCTGACCT ATACCAACAA CCTGCTCGTG       180
     GCACTCGCTG AACGCGGCGC CCCGTTTGTG CTGTGCGGCC CCAACCACAA TGCCATGGGT       240
     ATGCTGCTGC CCATCGACGG TCACCATGTA CAAGCCAAGC GCATCGAGGC GCAGATCGCG       300
     GCCAGCCTGC CTGTGCACAA GCGCCTGTGG GCGGCGGTGG TCAAGTCCAA GTTGGAGCAG       360
     CAGGCCGCCG CATTGGAGGC CGCTGCCGCC CCTACCGCTC CTTTGCTTGC ACTGGTGAGT       420
     AAGGTCAAAA GCGGCGACCC GGAGAACATC GAAGGGCAGG GCGCTCGCCG CTACTGGGGC       480
     CTGCTATTCG GTAACACCTT TCGCCGCGAC CAGAACGGTG ATGGCGTGAA CGCGCTGCTC       540
     AACTATGGCT ACACCATTCT GCGCTCGGCC ACGGCGCGGG CAGTGGTGGC TGCGGGTTTG       600
     CACCCGAGCA TAGGCTTGCA TCACAGCAAC GATAGCAATG CCATGCGCTT GGTGGATGAT       660
     CTGATGGAGC CCTTCCGCCC CGTGGTGGAT TTGAAGGTGT GGCAATTGCT GGCCCAGGGG       720
     GAAGCGCACG TCACCCCGGA AACCAAGCGC GCTCTTGTGC GTGTGCTGTA TGACGATATG       780
     CAGACCAGCG TGGGCGTGAC GCCTGTGATG GTCTGCATGC AAAAACTCGC CATCTCCCTC       840
     GCGCAGGTCT ACTTAGGCGA GCGCACGAAA CTCGATTTAC CTCTACAGGG TTTGCCTTTG       900
     GCCTTGGCGG GAAGTTCCGA GTCGGACTGA                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page