(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE204

ALDEN1_2.PE204       Location/Qualifiers
FT   CDS_pept        232438..232743
FT                   /locus_tag="Alide_0207"
FT                   /gene_family="HOG000022401" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01573"
FT                   /codon_start="1"
FT                   /product="crispr-associated protein cas2"
FT                   /transl_table="11"
FT                   /note="KEGG: vei:Veis_1232 CRISPR-associated Cas2 family
FT                   protein; TIGRFAM: CRISPR-associated protein Cas2; PFAM:
FT                   Virulence-associated protein D / CRISPR associated protein
FT                   Cas2"
FT                   /db_xref="GI:319760942"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="GeneID:10102230"
FT                   /translation="MWMVVMFDLPVVEKSERRAATGFRNALLDLGFEMSQFSVYMRFCT
FT                   SQTQVDTLCRNVETALPPGGKVHIFQFTDKQYERAITFHGQRRQPGQKAPDQFDLF"
FT                   /protein_id="YP_004124879.1"
     ATGTGGATGG TGGTGATGTT CGATTTGCCC GTGGTGGAAA AGTCTGAGCG GCGCGCGGCC        60
     ACGGGCTTTC GCAACGCATT GCTGGACTTG GGCTTCGAGA TGAGCCAGTT CAGCGTCTAC       120
     ATGCGGTTCT GTACCAGCCA AACACAGGTG GACACCCTGT GTCGCAACGT GGAAACGGCC       180
     TTGCCGCCAG GCGGAAAAGT CCATATCTTC CAATTCACAG ACAAGCAGTA CGAACGTGCC       240
     ATCACCTTCC ATGGCCAGCG TCGCCAACCA GGCCAAAAAG CACCCGATCA GTTCGATCTT       300
     TTCTGA                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page