(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE205

ALDEN1_2.PE205       Location/Qualifiers
FT   CDS_pept        complement(233693..234955)
FT                   /locus_tag="Alide_0209"
FT                   /gene_family="HOG000289491" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03743"
FT                   /codon_start="1"
FT                   /product="conjugation trbi family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: conjugation TrbI family protein; KEGG:
FT                   ajs:Ajs_2902 conjugation TrbI family protein"
FT                   /db_xref="GI:319760943"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="GeneID:10102232"
FT                   /translation="MSQDDSPDLAPQAGKVVPEAVALRAQPRPVTRLNRRTLVMLTGGL
FT                   SVAVLGATIWSLQPHRRAGEQTELYNVDRVSKSEGLDGLPSDYSKLPKVPELGPPLPGD
FT                   LGPAIVKSQQPVAPTYAPPGHDPEDARRKEAEAAAASSVFFRSGTPGKTAAPATAQVAA
FT                   AGQASALAGFDPLAAGPASTAAQPADPTAVQNRQDQKEAFLKGGSTETRNSGNLKMPSS
FT                   PYQVMAGTVIAGALVTGIKSDLPGDVIATVTEPVYDTATGKFLLIPQGSRILGKYNSQV
FT                   SYGQSRVQVVWNRIILPDTSSLTLDNLVGTDPAGYSGLEDGVDYHWSRIVAGAALTTML
FT                   GVGAELAAPENRQDGNRIVIAGRDSAQDSINQVGQEMTRRNMNIQPTLTERPGLPVRII
FT                   ANRDLVLRPYQPMFFQRGAIR"
FT                   /protein_id="YP_004124880.1"
     atgagccagg acgattcccc tgaccttgca ccgcaggcgg gcaaggtcgt gcccgaggcg        60
     gtggcgctgc gcgcccagcc gcgcccggtc acacgcctga accggcgcac gctagtcatg       120
     ctcaccggcg gcctgtcggt cgccgtgctc ggggctacga tctggtcatt gcagccgcac       180
     cggcgcgcgg gtgagcagac cgagctgtac aacgtcgatc gcgtgtcgaa gtccgaaggg       240
     ctggatggct tgccttcgga ttactccaag ctgccgaagg tgccggaact ggggccgccg       300
     ctgccgggcg accttggccc ggccatcgtg aagtcgcagc agcccgtggc gcccacctac       360
     gcgccgccgg gccacgaccc ggaggatgca cggcgcaagg aagctgaagc ggcagcagct       420
     tcctcggtgt tcttccgctc gggcacgcct ggcaagaccg ccgcgccagc gactgcgcaa       480
     gtcgctgcgg ctggccaagc atcggccttg gcgggcttcg acccgctggc cgccgggcca       540
     gcctcgacgg cggctcagcc tgccgacccg accgctgtgc aaaaccggca agaccaaaaa       600
     gaggcgttcc tgaagggcgg ctctacggag acccgcaatt ccgggaatct gaaaatgccg       660
     tcctcgccgt atcaggtgat ggccgggacg gtgatcgccg gcgcgctggt gacgggcatc       720
     aagtcggact tgccgggcga cgtgatcgcc acggtgacgg agccggtcta cgacacggcc       780
     acgggcaagt tccttttgat cccgcagggg tcgcgcatcc tgggcaagta caacagccag       840
     gtcagctatg ggcagagccg ggttcaggtg gtgtggaacc ggatcatcct gccggacacg       900
     tcctcgctga cgctggacaa cctcgtgggt accgatccgg ccggctattc cggcctggaa       960
     gacggtgtgg actaccactg gagccgcatc gtcgccggtg ctgcgctgac gacgatgctg      1020
     ggcgtgggcg ccgagctggc cgcgccggag aaccggcagg atggcaatcg catcgtaatc      1080
     gccgggcgcg acagcgcgca ggacagcatc aaccaggttg gccaggaaat gacccgacgc      1140
     aacatgaaca tccagccaac gctgactgaa cggcccggcc tgccggtgcg gatcatcgct      1200
     aaccgcgatc tggtgttgcg tccgtaccag ccgatgttct tccagcgtgg agccattcga      1260
     tga                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page