(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE206

ALDEN1_2.PE206       Location/Qualifiers
FT   CDS_pept        complement(234957..235937)
FT                   /locus_tag="Alide_0210"
FT                   /gene_family="HOG000289480" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02775"
FT                   /codon_start="1"
FT                   /product="p-type conjugative transfer protein trbg"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_2903 conjugal transfer protein
FT                   TrbG/VirB9/CagX; TIGRFAM: P-type conjugative transfer
FT                   protein TrbG; PFAM: Conjugal transfer protein
FT                   TrbG/VirB9/CagX"
FT                   /db_xref="GI:319760944"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR014142"
FT                   /db_xref="GeneID:10102233"
FT                   /translation="MNDLFRKSVLPVILLALSACATQGKPPPSISLDEPVQAQPLPEPP
FT                   APVEVVAMPQVLPMPAQMKPVPDAKPAAEPADETVRVSRANAEARIAPTREGYVNAIQV
FT                   WPFTDGALYQVYAAVGRVTVIALQPGEELVTVAAGDTVRWIVGDTSSGSGDALRVNVMV
FT                   KPIRSGLKTNLVITTSRRTYLIELTSTEKTWMASVSWEYPKDKMLALQRQAQAASAAAP
FT                   VDSGLSLEKIRFRYAVSGSNPPWKPLRAFDDGEKVYIQFPPGIAQGELPPLFVIGAQGD
FT                   GQLVNYRFRSPYYIVDRLFGAAELRLGGDKGDVVRIERTDGTRRN"
FT                   /protein_id="YP_004124881.1"
     atgaatgatc ttttccgtaa atccgtcttg ccggtgatcc tgcttgccct gtcggcctgc        60
     gccacgcagg gcaagccgcc gccgtccatc tcgctcgatg agccggtgca ggcgcagccg       120
     ctaccggagc cgcctgcgcc ggtggaggtg gtggccatgc cgcaagtgct gccgatgccg       180
     gctcagatga agcctgtgcc ggatgccaag cccgccgcag aacccgccga tgaaaccgtg       240
     cgcgtgtccc gcgccaatgc cgaagcgcgc attgcgccga cgcgcgaggg ctacgtcaac       300
     gcaatccagg tgtggccctt cacggacggc gcgctatatc aggtctatgc ggccgtgggc       360
     cgcgtgacgg tgatcgcgct ccagccgggc gaggaactgg tgactgtcgc tgctggcgac       420
     acggtgcgct ggatcgtggg cgacacgtcc agcggcagcg gcgacgcctt gcgcgtcaat       480
     gtgatggtca agccgatccg ctcgggcctc aagaccaatc tggtcatcac gaccagccgg       540
     cgcacgtacc tgattgagct gacttcgacc gagaagacgt ggatggcgtc ggtgtcctgg       600
     gagtatccga aagacaagat gctggccttg cagcgccagg cgcaggcggc cagcgccgcc       660
     gcgccggtcg atagcgggct atcgctggag aagatccgtt tccgctacgc ggtcagtggc       720
     agcaacccgc cgtggaaacc gctgcgcgcc ttcgatgatg gcgagaaggt ctatatccag       780
     ttcccgccgg gcatcgccca gggcgagttg ccaccgctgt tcgtcatcgg cgcgcaaggt       840
     gacgggcaac tggtgaacta ccgtttccgc tcgccgtact acatcgtgga tcgcctgttc       900
     ggcgcggccg aactgcgcct gggcggggac aagggcgacg tggtgcggat tgagcgcacg       960
     gacggcacaa ggaggaattg a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page