(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE207

ALDEN1_2.PE207       Location/Qualifiers
FT   CDS_pept        complement(235934..236638)
FT                   /locus_tag="Alide_0211"
FT                   /gene_family="HOG000289469" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Rpic_2651"
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein trbf"
FT                   /transl_table="11"
FT                   /note="KEGG: rpi:Rpic_2651 conjugal transfer protein TrbF"
FT                   /db_xref="GI:319760945"
FT                   /db_xref="GeneID:10102234"
FT                   /translation="MQFKRPQVRYADTPQPATPYQSAAQVWDERIGSTRVQAKNWRFMA
FT                   FGCLTLAVLMAGGLVWRSAQSIVTPYVIEVDNAGQVRAVGEAAAPYKPSDAQVAYHLGR
FT                   FIGLVRSLSIDPIVVRQNWLDAYDYTTDKGAVVLNEYARVNDPFARIGKESVTVQITSV
FT                   TRASDTSFNVRWTETRFVNGALDRTERWNAVVSIVQQTPRTEQRVRKNPLGIYVNGLSW
FT                   SRELEGNEGAKP"
FT                   /protein_id="YP_004124882.1"
     atgcaattca aacgaccgca ggtgcgctac gccgacacgc cgcagcctgc caccccgtac        60
     cagtccgccg cacaggtgtg ggacgagcgc atcggctcga cccgcgtgca ggcgaagaac       120
     tggcgtttca tggccttcgg ctgcctcacc ttggccgtgc tgatggcggg cgggctggtt       180
     tggcgttccg cgcagtccat cgtgacgccc tacgtcatcg aggtggacaa cgcgggccag       240
     gtgcgcgccg tgggcgaagc cgccgcgccc tacaagccca gtgatgccca ggtggcctat       300
     cacctgggcc gcttcatcgg cctggtgcgc tcgctgtcca tcgaccccat cgtggtgcgg       360
     cagaactggc tggatgccta tgactacacc accgacaaag gcgccgtggt gctcaacgag       420
     tacgcccgcg tgaacgatcc gttcgcgcgc atcggcaagg agtcggtgac ggtgcagatc       480
     accagcgtga cccgcgccag cgacacgtct ttcaacgtgc gctggacgga gacgcgcttc       540
     gtgaacggtg cgctggatcg cactgaacgc tggaacgcgg tggtttccat cgtgcagcag       600
     acgccgcgca ccgagcagcg tgtgcgcaag aaccccctgg gcatctacgt caacgggctg       660
     tcgtggagcc gcgaactgga aggaaacgaa ggagcaaaac catga                       705
//

If you have problems or comments...

PBIL Back to PBIL home page