(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE209

ALDEN1_2.PE209       Location/Qualifiers
FT   CDS_pept        complement(238004..238729)
FT                   /locus_tag="Alide_0213"
FT                   /gene_family="HOG000289447" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02780"
FT                   /codon_start="1"
FT                   /product="p-type conjugative transfer protein trbj"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: P-type conjugative transfer protein TrbJ;
FT                   KEGG: ajs:Ajs_2907 conjugal transfer protein TrbJ"
FT                   /db_xref="GI:319760947"
FT                   /db_xref="InterPro:IPR014147"
FT                   /db_xref="GeneID:10102236"
FT                   /translation="MKRRLLAAAVAAMLCTATAHAQWVVIDPTNLIQNTLTAIQTLEQI
FT                   YNQIKQLENEAQMLRNQARNLASLPSSVVGQLRANLATTQRLIAQARGLAYDVTNLDRE
FT                   FQRLYPEQYAATVSGNQMYRDAQERWKNTLNGLQTTMQMQAQASQNLSDDESVLADLVG
FT                   KSQSAVGALQAMQATNQLLALQAKQSIQTQRLNITQDRAASLELARQAAAVERGREVNR
FT                   RFLGGGTPYTPQTVDFYSR"
FT                   /protein_id="YP_004124884.1"
     atgaaaaggc gtctactcgc cgccgccgtc gcggccatgc tttgcaccgc cactgcccat        60
     gcgcaatggg tcgtgatcga ccctacgaac ctgatccaga acacgctgac ggccatccag       120
     acgctggagc agatctacaa ccagatcaag cagcttgaga acgaggcgca gatgctgcgt       180
     aaccaggcgc gcaacctggc cagcctgccg tccagcgtgg tcggccagtt acgcgccaac       240
     ctggcgacca cccagcggct gatcgcccag gcccgaggcc tggcttatga cgtgacgaat       300
     ctggatcggg agttccagcg cctgtatcca gagcaatacg ccgccacggt gagcggcaac       360
     cagatgtacc gcgacgcgca ggaacgctgg aagaacacgc tcaatggctt gcagaccacc       420
     atgcagatgc aggcccaggc atcgcagaac ctgagcgatg acgaaagcgt gctggccgac       480
     ctcgtgggca agagccaatc ggccgtgggt gctttgcagg ccatgcaagc caccaaccag       540
     cttctggcct tgcaggccaa gcagtccatc cagacacagc gcctgaacat cactcaggat       600
     cgtgccgctt cgctagagct ggcgcggcag gccgccgctg tggagcgggg ccgcgaggtg       660
     aaccggcgct tcttgggtgg aggcacgccg tacacgcctc agaccgtcga tttttatagc       720
     cgctga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page