(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE210

ALDEN1_2.PE210       Location/Qualifiers
FT   CDS_pept        complement(238726..241161)
FT                   /locus_tag="Alide_0214"
FT                   /gene_family="HOG000289436" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03135"
FT                   /codon_start="1"
FT                   /product="cage, trbe, virb component of type iv transporter
FT                   system, conserved region protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_2908 conjugal transfer ATPase TrbE;
FT                   PFAM: CagE, TrbE, VirB component of type IV transporter
FT                   system, conserved region; SMART: AAA ATPase"
FT                   /db_xref="GI:319760948"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="GeneID:10102237"
FT                   /translation="MLNLAEYRQRPALLADWLPWAGLVAPGVVLNKDGSFQRTARFRGP
FT                   DLDSATQGELIATAARLNNALRRLGSGWALFIEAERRAAADYPHSEFPEPLSWLVDEER
FT                   RATFEDSGNHFESGYHLTLVYLPPEESRARAAGMLYENRPTEGVDWRERLTAFVAETDR
FT                   VFDLLDGVMPEIAWLDDGQTLTYLHSTISTRRYRVSVPEVPFHIDALLTDSALVGGLAP
FT                   MLGDQHLRVVSVRGFPTSTWPGILDDLNRLGFGYRWSTRFLCMDKADAEKELSRLRRQW
FT                   FAKRKNVIALLRETIFQQETPLVDTDASNKSADADAALQELGSDQVAFGYVTTTVTVLD
FT                   ADPAKADEKLRMVERVIQGRGFVTIPETLNAVEAWLSSIPGHAYANVRQPIVSTLNLAH
FT                   LMPVSAVWAGPEKNSHLDGPPLIVTRTEGATPFRLVTHIGDVGHTLVAGPTGMGKSVLL
FT                   ATLAMQFRRYRGSRIFAFDMGRSMRATILGLAGEHYDLGMDGEIAFQPLARIDREGYRT
FT                   WAAEWIEGRLRHEGVAVGPDEKVAIWSALGSLAGAPVEQRTMTGLSVLLQSNSLRQALA
FT                   PYVLGGAHGKLLDADHDRLGMADVQCFEMEELMHSKAAVMAVLHYLFARFDERFDGAPT
FT                   LLILDEAWLFLDDPVFAARIRQWLKTLRKKNVSVIFATQSLADIKDSSIAPAIIESCAS
FT                   RIFLPNPQATEPQIRAIYEGFGLNSRQIEIVATGQPKRDYYYQSRLGNRLFDLDLGPAA
FT                   LAFAGASTPQDQRDIDAVLAASSAVTPFAAAWLRHRGLHWAADLLSTFPSTHLQENPS"
FT                   /protein_id="YP_004124885.1"
     atgctgaacc ttgccgaata ccgccagcgg cccgcgctgc tggccgactg gctgccttgg        60
     gctggactgg ttgcgccggg cgtcgtcctg aacaaggacg gcagtttcca gcgcacggcg       120
     cgctttcgtg gccccgacct cgatagcgca acgcagggcg agctgatcgc cacggctgcg       180
     cggttgaaca acgcgctgcg ccggctcggt tcgggctggg cgctgttcat cgaggccgag       240
     cgccgcgccg ccgccgacta tccgcactcg gagtttcccg agccgctttc gtggctggtg       300
     gacgaggaac gccgcgctac gttcgaggac tcgggcaacc acttcgagag cggctaccac       360
     ctgacgctgg tgtacctgcc gcccgaggaa tcgcgcgccc gcgcggcggg gatgctgtac       420
     gagaaccggc ccaccgaagg cgtggactgg cgcgagcgcc tgacggcctt cgtggcggaa       480
     accgatcgcg tcttcgacct gctcgatggc gtgatgccgg aaatcgcctg gctcgatgac       540
     ggccagacgc tgacctatct gcactcgacc atctccacgc ggcgctaccg cgtcagcgtg       600
     cccgaagtgc cattccacat cgacgcgctg ctgacggatt ccgcactggt tggcggcctg       660
     gcgcccatgc tgggcgacca gcacctgcgc gtggtgtcgg tgcggggctt cccgacctcg       720
     acctggccgg ggattctgga cgacctcaac cgcctcggct ttggctatcg ctggtcaacc       780
     cggttcctct gcatggacaa agccgatgcg gaaaaggaac tttcccgcct gcgccgccaa       840
     tggttcgcca agcgcaagaa cgtcatcgcg ctgctgcgcg aaaccatctt ccagcaggaa       900
     accccgctgg ttgataccga cgccagcaac aaatcggccg atgcagacgc agcgttgcag       960
     gagctgggca gcgaccaggt ggccttcggg tatgtcacca ccacggtgac ggtgctcgac      1020
     gccgacccgg caaaggccga cgagaagctg cgcatggtgg aacgggtgat tcaagggcgt      1080
     gggttcgtga cgatccccga gaccttgaac gcggtggagg cgtggctgtc gtcgattccc      1140
     ggccacgcct acgcgaacgt ccgccagccc atcgtctcga cgctgaactt ggcgcacctg      1200
     atgccggtgt ccgccgtatg ggccgggccg gagaaaaact cccacctcga cggcccgccg      1260
     ctgatcgtga cccgcaccga aggcgcaacg ccattccggc tggtcacgca catcggcgac      1320
     gtgggccaca cgctggtggc cgggccgacc ggcatgggca agtccgtcct gctcgctacg      1380
     ctggcgatgc agtttcggcg ttatcgcggc tcacgcatct tcgccttcga catggggcgc      1440
     tcgatgcgcg ccacgatcct gggcctggcc ggcgagcact acgacctcgg gatggatggc      1500
     gagattgctt tccagccgct ggcccgcatc gaccgtgagg gctaccgcac ctgggcggcc      1560
     gaatggatcg aagggcgctt gcggcacgaa ggtgtcgcgg tcggccccga cgagaaggtt      1620
     gccatctggt cggcgctcgg cagtctcgct ggtgcgcccg tggagcagcg cacgatgacg      1680
     ggtctgtcgg tgctgctgca atcgaactcg ctgcggcagg cgctcgcgcc ctatgtgttg      1740
     ggtggcgcgc acggcaagct gctggacgcc gaccatgatc ggctgggcat ggccgacgtg      1800
     cagtgcttcg agatggagga gctgatgcac agcaaggccg ccgtcatggc cgtgctgcat      1860
     tacctctttg cgcgcttcga tgaacgcttt gacggtgcgc ccacgctgct gatcctcgat      1920
     gaagcgtggc tgttcctcga tgacccggtg tttgcggcgc gcattcgcca gtggctcaag      1980
     acgctgcgca agaagaacgt cagcgtcatc ttcgccacgc agagcctggc cgacatcaag      2040
     gattcgagca tcgcgcccgc gatcatcgaa agctgcgcga gccgcatctt tctgccgaac      2100
     ccgcaggcga ccgagccgca aatccgagct atctacgaag gcttcggcct caacagccgc      2160
     cagatcgaga tcgtcgctac cgggcagccc aagcgcgact actactacca atcccgcctc      2220
     ggaaaccgcc tgttcgacct cgacttgggg ccggcggcgc tcgccttcgc gggtgcgtcc      2280
     acaccgcaag accagcgcga catcgacgcg gtgctcgccg cttcatccgc tgtcaccccg      2340
     tttgcagccg cgtggctgcg ccatcgcggc ctgcattggg ccgccgacct gctttccacg      2400
     ttcccgtcca cccacctcca ggagaaccca tcatga                                2436
//

If you have problems or comments...

PBIL Back to PBIL home page