(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE211

ALDEN1_2.PE211       Location/Qualifiers
FT   CDS_pept        complement(241171..241443)
FT                   /locus_tag="Alide_0215"
FT                   /gene_family="HOG000289425" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_2909"
FT                   /codon_start="1"
FT                   /product="conjugal transfer trbd transmembrane protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_2909 conjugal transfer TrbD
FT                   transmembrane protein"
FT                   /db_xref="GI:319760949"
FT                   /db_xref="InterPro:IPR016704"
FT                   /db_xref="GeneID:10102238"
FT                   /translation="MNGPHDGMPGFEVPLHRSLTEPILMGGAPRTVAITNGTLAAAVGL
FT                   GLQLWIPGVVLWIAGHSLAVWGARVDPQFMAVFARHIKHRPLLDV"
FT                   /protein_id="YP_004124886.1"
     atgaacggcc cgcacgatgg aatgcccggc ttcgaggtgc cgctacatcg gtctctgacc        60
     gagccgatcc tgatgggcgg cgctccgcgc accgtggcca tcaccaacgg cacgctggcc       120
     gccgccgtgg gcctgggcct gcaactgtgg attcccggcg tggtgctgtg gatcgccggc       180
     cattcgctgg cggtgtgggg tgcccgagtc gatccgcagt tcatggccgt gttcgcgcgg       240
     cacatcaagc accggccgct gctggacgtg tga                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page