(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE212

ALDEN1_2.PE212       Location/Qualifiers
FT   CDS_pept        complement(241440..241817)
FT                   /locus_tag="Alide_0216"
FT                   /gene_family="HOG000289414" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04956"
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein trbc"
FT                   /transl_table="11"
FT                   /note="PFAM: Conjugal transfer protein TrbC; KEGG:
FT                   dac:Daci_2698 conjugal transfer protein TrbC"
FT                   /db_xref="GI:319760950"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="GeneID:10102239"
FT                   /translation="MTHVDAFRISANPLPRPARLHGLARPAIQGLMLAAFMLLLAGTAQ
FT                   AAGSSMPWEGPLQSILESIQGPVARIVAVIIIIATGLALAFGDTSGGFRKLIQIVFGLS
FT                   IAFAASSFFLSFFSFSGGAVV"
FT                   /protein_id="YP_004124887.1"
     atgacgcacg ttgatgcttt ccgtatttcc gcaaatccgc ttcctcggcc cgcacggctg        60
     catggcttgg ctcgcccggc cattcagggc ttgatgctcg ctgccttcat gctgctgctc       120
     gcaggtactg cgcaggccgc cggttcttcg atgccctggg aaggaccgct gcaatctatc       180
     ctcgaatcca tccaggggcc ggtggcgcgc atcgtcgcag tcatcatcat catcgccacg       240
     ggcttggcgc tggccttcgg cgatacctcg ggcggcttcc gcaagctgat ccagatcgtg       300
     tttggcctgt ccatcgcgtt cgccgcttcg agcttcttcc tgtcgttctt cagcttctcc       360
     ggtggggccg tcgtatga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page