(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE213

ALDEN1_2.PE213       Location/Qualifiers
FT   CDS_pept        complement(241814..242848)
FT                   /locus_tag="Alide_0217"
FT                   /gene_family="HOG000119938" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02782"
FT                   /codon_start="1"
FT                   /product="p-type conjugative transfer atpase trbb"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_2911 type II secretion system protein
FT                   E; TIGRFAM: P-type conjugative transfer ATPase TrbB; PFAM:
FT                   type II secretion system protein E"
FT                   /db_xref="GI:319760951"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014149"
FT                   /db_xref="GeneID:10102240"
FT                   /translation="MSAVPSFTAVSLDRRIQMLRTAMGPLIAAALEDPDVVEVMLNPDR
FT                   TLWIDRLSSGRAPMGVELSEADGERIIRLVAAHVGAEVHRGQPLLTAELPETGERFEGI
FT                   LPPAAPGPAFALRKRAFGVIPLSRYIEDGMMTAAQAGLLVRAVRERQNILIAGGTSTGK
FT                   TTLANALLAEIAATGDRVLVLEDTVELQCAARDHVPLRTRQGVVSMTELVRSSMRLRPD
FT                   RVVVGEVRGAEALDLIKVWGTGHPGGIATIHAGSALGALLRLEQLILEVAVNPPRALIA
FT                   EAVNVVIHIAGRGRKRRIESIARVIGFDGVGYHLADALEAPFPELLPQSDLSSPSPDHS
FT                   GELP"
FT                   /protein_id="YP_004124888.1"
     atgagcgccg ttccttcctt caccgccgtt tccctggatc gccgcatcca gatgctgcgc        60
     acggcaatgg ggccgctgat cgccgccgcg ctggaagacc ccgacgtagt ggaagtcatg       120
     ctgaacccgg atcgaacctt gtggatcgac cggctttcgt cgggtcgcgc accgatgggt       180
     gtggagctgt ccgaggcgga cggtgaacgc atcatccgcc tcgtcgcggc ccacgtcggc       240
     gccgaggtgc atcgcggtca gccgctcctg acggcggagc tgcccgagac gggcgagcgc       300
     ttcgagggca tcttgccgcc cgccgcaccg gggccggcct tcgccttgcg caagcgcgcc       360
     tttggcgtga tcccgctgtc gcgctacatc gaggacggaa tgatgaccgc cgcgcaggcg       420
     ggtctgctgg tgcgcgccgt gcgcgagcgc caaaacatcc tgatcgcagg tgggacgagc       480
     accggcaaga ccaccttggc caatgcgcta ctggcggaga tcgccgccac gggcgaccgc       540
     gtgctggtgc tcgaagacac tgtggagctg caatgcgcgg cccgcgacca tgtgccgctg       600
     cgcacacgcc agggcgtcgt gtccatgacc gagttggtgc gttcgtccat gcgcctgcgc       660
     ccggatcgcg tggtcgtcgg cgaggtacgc ggcgccgaag cgctggatct catcaaggtg       720
     tggggtacag gccatccggg cggcattgcc acgatccatg ccggctccgc gctgggcgcg       780
     ctgctgcgtt tggagcaact gatcctcgaa gtggcggtga acccgccccg tgcgttgatc       840
     gcggaagcgg tcaatgtggt catccacatc gctgggcgcg ggcgcaagcg ccgcatcgag       900
     agcatcgccc gcgtcatcgg cttcgatggc gtgggctacc acctggcgga tgcgcttgag       960
     gctccattcc cggagctgct gccgcagtcc gacctttcct ccccgtcccc cgaccactct      1020
     ggagaacttc catga                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page