(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE214

ALDEN1_2.PE214       Location/Qualifiers
FT   CDS_pept        complement(242845..243291)
FT                   /locus_tag="Alide_0218"
FT                   /gene_family="HOG000289403" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_2912"
FT                   /codon_start="1"
FT                   /product="copg/DNA-binding domain-containing protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_2912 CopG/DNA-binding
FT                   domain-containing protein"
FT                   /db_xref="GI:319760952"
FT                   /db_xref="GeneID:10102241"
FT                   /translation="MTQHRLNVFIQPEHGKRLDELAAKKGVSKSSIVAAALASWLSPDA
FT                   ADQREAAIAKRLDRLSRHAERMERDLNIQIETLALFIRYFLTVSTPVPEAHQDAARAQG
FT                   KARFEQFVEQLGRHLLRGRSLVRDVVEELHPDPARMDDAQERAS"
FT                   /protein_id="YP_004124889.1"
     atgacccaac accgcctcaa cgtgttcatc cagcctgagc atggcaagcg gctcgacgaa        60
     ctggccgcca agaaaggcgt atccaagtcc agcatcgtcg ctgccgcctt ggcatcgtgg       120
     ctgtcgcccg atgccgccga ccagcgcgaa gcagcaattg ccaagcgcct ggatcgcttg       180
     tcacggcacg ccgagcgcat ggagcgcgac ctgaacatcc agatcgagac gctggcactg       240
     ttcatccgct acttcctcac ggtgagcacg cccgtgcccg aagcgcatca ggacgcagcg       300
     cgcgcccagg gcaaggcgcg cttcgagcag ttcgtcgaac aactcgggcg gcatttgctg       360
     cgcggtcgca gtctggtgcg ggacgtggtg gaagaactgc atccagaccc ggcacgcatg       420
     gacgacgcgc aggagcgcgc gtcatga                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page