(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE215

ALDEN1_2.PE215       Location/Qualifiers
FT   CDS_pept        complement(243288..245291)
FT                   /locus_tag="Alide_0219"
FT                   /gene_family="HOG000289392" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02534"
FT                   /codon_start="1"
FT                   /product="trag family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: TRAG family protein; KEGG: dac:Daci_2701
FT                   conjugal transfer coupling protein TraG"
FT                   /db_xref="GI:319760953"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="GeneID:10102242"
FT                   /translation="MMQGTNVLFGQIAVVFGIVIAGVWSATQWTAAALGYQLRLGSPWF
FT                   DFFGTPVYHPWRLFEWWFVFDAYAPRVFDTGGAIAGGSGLLAVVVAIGMSIWRSRQSRL
FT                   VTTYGSARWANADDIRKAGLTQPTGVFLGQHDHQYLRHEGPEHILTFAPTRSGKGVGLV
FT                   VPTLLSWPASAVIHDIKGENWQITAGWRSRFSHCLLFNPTDSQSAAYNPLLEVRRGVHE
FT                   VRDVQNIADILVDPEGALEKRNHWEKTSHALLVGAILHVLYAGEDKTLCGVANFLSDPA
FT                   CPFELTLHRMMTTLHLGDRSHPVVASAAREVLNKSDNERSGVLSTAMSFLGLYRDPTVA
FT                   EVTSRCDWRIADLIAAEHPVSLYLVVPPSDISRTKPLIRLILNQIGRRLTESLDGSDGI
FT                   ERRHKLLLMLDEFPALGRLDFFETALAFMAGYGIRSFLIAQSLNQIDKAYGQNHSILDN
FT                   CHVRVTFATNDERTAKRISETLGTATELRAQRNYAGHRLAPWLGHLMVSRQETARPLLT
FT                   PGEVMQLPPDEAVVMVSSVAPIKAKKLRYYADANFKRRVLPPPVLAGGQYADAPPLRPD
FT                   DWSGLAIPAVPAAPATASADGLGSTDEGGPRRQPELSETVAYDPELAAPAADLGLLDDD
FT                   DDLPLPLPRQLDPAMQRTARLASLDPDDGIDL"
FT                   /protein_id="YP_004124890.1"
     atgatgcagg gaacgaacgt gctgttcggt cagattgccg tggtgttcgg catcgtgatc        60
     gctggggtgt ggagcgccac gcaatggaca gccgccgccc tgggctatca gctacgcctt       120
     ggctcgccct ggttcgattt cttcggtacg ccggtctatc acccgtggcg gctgttcgag       180
     tggtggttcg tcttcgatgc ctatgcgccg cgcgtgttcg acaccggcgg cgccatcgca       240
     ggcggcagcg gattgctggc ggtggtggtc gccatcggca tgtcgatctg gcgctcgcgg       300
     caatcgcgcc tggtcacgac ctacggctcg gcccgctggg cgaacgcgga tgacattcgc       360
     aaggccggcc tcacgcagcc gaccggcgtg ttcctcggcc agcacgacca ccagtacctg       420
     cgccatgaag gcccggaaca catcctgacc ttcgcgccca cgcgctcggg caagggcgtg       480
     ggcctcgtgg tgccgacgct gctttcctgg ccagcttcgg ccgtcatcca cgacatcaaa       540
     ggcgagaact ggcagatcac cgccggttgg cgctcgcgct tttcgcattg cttgctgttc       600
     aacccgacgg atagccagtc agcggcctac aacccgctgc tggaagtgcg gcgcggcgtg       660
     catgaagtcc gcgacgtgca gaacatcgcc gacattctgg tcgatcccga aggggcgtta       720
     gagaaacgca atcattggga gaagaccagc catgcgctgc tggtcggcgc gattctgcac       780
     gtgctctatg ccggcgagga caagacgctg tgcggcgtcg ccaacttcct gtctgacccg       840
     gcttgcccgt tcgagctgac gctgcaccgg atgatgacga ccctgcacct gggcgatcgc       900
     tcgcacccgg tggtggcgtc ggccgcgcgc gaagtgctca acaaatcgga caacgagcgt       960
     tccggcgtgt tgagcaccgc catgtcgttc ctcggcctgt accgtgaccc cacggtggcc      1020
     gaagtcacat cgcgctgcga ctggcgcatc gccgacctga tcgcggccga gcatccggtg      1080
     tcgctgtacc tggtggtgcc gccttcggac atttcgcgca cgaagccgct cattcgcctg      1140
     atcctcaacc agatcggccg gcgcctcacc gaatcgctcg atggctccga tggcatcgag      1200
     cgccgtcaca agctgctgct gatgctcgat gagtttccgg cgctggggcg cctggacttc      1260
     ttcgagacgg cgctggcctt catggcgggc tacggcatcc gcagctttct catcgcgcag      1320
     tcgctcaacc agatcgacaa ggcgtatggg cagaaccatt ccatcctcga caactgccat      1380
     gtgcgcgtga cgttcgccac gaacgacgag cgcaccgcca agcggatctc cgagacgctg      1440
     ggtacggcca ccgagctgcg cgcccagcgc aactacgcgg gccaccggct tgcgccgtgg      1500
     ctgggccacc tgatggtgtc gcgccaggaa accgcgcgtc cgctgctgac gccgggtgaa      1560
     gtcatgcagc ttccgcccga cgaggccgtg gtgatggtgt ccagcgtggc accgatcaag      1620
     gcgaagaagc tgcgctacta cgcggacgcc aatttcaagc gccgcgtgct gccgccgcct      1680
     gtgcttgcag gcggtcagta cgccgacgcg ccgccgctac gcccggacga ctggagcggg      1740
     ctggcgatcc ccgccgtgcc cgccgcaccg gccacggcat ccgccgatgg cctgggttcc      1800
     acggatgaag gcggcccgcg ccgtcagcct gaactctccg aaaccgtcgc ctacgacccc      1860
     gagctggccg cgcccgcagc cgacctcggg ttgctcgatg acgacgacga cttgccgctt      1920
     ccccttccgc gccagcttga tccggccatg cagcgcacgg cccggctggc ttccctcgac      1980
     cctgacgacg gaatcgacct atga                                             2004
//

If you have problems or comments...

PBIL Back to PBIL home page