(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE217

ALDEN1_2.PE217       Location/Qualifiers
FT   CDS_pept        complement(245815..246708)
FT                   /locus_tag="Alide_0221"
FT                   /gene_family="HOG000233514" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="lysr substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: sml:Smlt1302 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:319760955"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:10102244"
FT                   /translation="MELRHLRYFLAVAEELHFARAAERLHIEQSPLSRAIRELEEELGA
FT                   QLFVRTSRSTRLTLAGKLLMENAPRVLLALDQARESVKAAANGFHGRLRVALSDGITPS
FT                   RLPALLARCREEDPEIEIRLFEVPLAQQLSGLRDDLYDAGFSMADEVGDGIIIEPAWED
FT                   ELMVAMPARHELLAHRRVPLDEVLQHPLVLGDPAVCEGHAKQIDRILRKQDREPLIEQY
FT                   VATFDVMMTFVSAGLALGLAGAAHIASSREPGVVGRPLAGKSPMLTTYLLRRDAEPSQA
FT                   LARFIERVEALGPGDA"
FT                   /protein_id="YP_004124892.1"
     atggaattgc gtcacctccg gtactttctg gccgttgccg aagagcttca cttcgcccgc        60
     gctgcggagc ggctgcatat cgaacagtca ccactgtcgc gcgccatcag ggaattggaa       120
     gaggaattgg gcgcgcaact gttcgtgcgt accagccgca gcacgcgcct gacgctggcg       180
     ggcaagctgc tgatggagaa cgcgcctcgc gtgctgctgg cgctggacca ggcgcgtgag       240
     agcgtgaagg cggcagccaa tggctttcac ggccggttgc gcgtggcgct gtccgacggc       300
     atcaccccct cgcgcctgcc ggcgctgctg gcgcgctgcc gcgaggaaga cccggagatc       360
     gagatccgcc tgttcgaggt gccgctggcc cagcaactca gcggcctgcg tgacgatcta       420
     tacgacgcgg gcttctcgat ggccgacgag gtgggcgacg gcatcatcat cgaacccgcc       480
     tgggaggatg agctgatggt cgccatgccc gcgcgccatg aactactggc ccacaggcgg       540
     gtaccgctgg atgaagtgct gcaacatccc ctggtgctgg gcgacccggc agtttgcgaa       600
     ggccatgcca agcagatcga ccgcatcctg cgcaagcagg accgggagcc cttgatcgaa       660
     cagtacgtcg ccacgttcga cgtgatgatg actttcgtgt cggccggctt ggcgctgggg       720
     ctcgcaggcg ccgcgcacat cgcttccagc cgcgagccgg gcgtggtggg ccgaccgctc       780
     gcgggaaagt cgcccatgct cactacctat ctgctgcgcc gcgacgccga gccgtcgcag       840
     gcgctagccc gctttatcga gcgggtcgaa gccctgggac cgggagacgc ttag             894
//

If you have problems or comments...

PBIL Back to PBIL home page