(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE219

ALDEN1_2.PE219       Location/Qualifiers
FT   CDS_pept        complement(249983..251575)
FT                   /locus_tag="Alide_0223"
FT                   /gene_family="HOG000144730" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /codon_start="1"
FT                   /product="efflux transporter, rnd family, mfp subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_1848 RND family efflux transporter MFP
FT                   subunit; TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein"
FT                   /db_xref="GI:319760957"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="GeneID:10102246"
FT                   /translation="MKPETNKLNVGKKQWIAIVVIAAVGIGLGSAILGGKTGKSAEGEG
FT                   HGSHVEAKAHSDGEHHGKTGADSHEDDKGHADGEHHEGSSKGPHGGKLFKEGDFGLEAL
FT                   LAEDGGEPRLRIWLYEKEKALASSAAKVSATVTRLTGEKQALNFTPDKDSLLSREIVPE
FT                   PHAFEINIVAQTANAPFTFSFSQEEGKVELSDAQIKAASIGIDTAGAASIKSALQLPGE
FT                   IRLNEDRTSHVVPRIAGVVESVQASLGQTVKKGQVLAVIASPAASEQRSELQTAQKRLA
FT                   LAQTTFEREKRLWEQKISAEQDYLQAGQALNEAQVAVANAQQKLSAVGLAPGSSGGLNR
FT                   FELRAPFDGVVIEKHLSLGEAVKEDAAVFTVSDLGQVWAEINVPAKDLPLVRVGEKVSI
FT                   KATAFDASAQGTITFVGALIGEQTRMAKARVVLANPQGAWRPGLFVNVEVIASETAVPV
FT                   SVASDAIQSVGDKPVVFVKVKDGFVAQPVQLGRSDGKRVEVLQGLQAGAAYAAAGSFVV
FT                   KSELGKASAEHTH"
FT                   /protein_id="YP_004124894.1"
     atgaaacccg aaacgaacaa actgaacgtc ggcaagaagc agtggattgc catcgtcgtg        60
     atcgccgcag tgggcatagg actgggcagc gccattctcg gcggcaagac gggcaagagc       120
     gccgagggcg agggccacgg cagccacgtt gaagccaagg cccacagtga tggtgagcat       180
     catggcaaga caggcgcaga ctcccacgag gacgacaaag gccatgcgga cggcgagcac       240
     cacgagggat caagcaaggg cccgcatggc ggcaagctgt tcaaagaagg ggactttgga       300
     ttggaagcct tactcgctga ggacggcggc gaaccacgtc tgcgaatctg gctttacgaa       360
     aaggaaaagg cgctagccag cagcgccgcc aaggtcagcg ctaccgttac acgcttgact       420
     ggggagaagc aggcgctcaa cttcacgccc gacaaggaca gcctgttgag tcgagagatt       480
     gtgccggaac cccatgcgtt cgagatcaac atcgtggctc agacggccaa cgcgcctttc       540
     acgttcagct tcagccagga ggaaggaaaa gttgaactca gcgatgcgca aatcaaggca       600
     gcatccatcg gaattgacac cgcaggggcc gcaagcatca agtccgccct gcaattgccg       660
     ggtgagatta ggctgaatga agaccgcacc tcgcacgttg ttccgcgcat tgcgggtgtt       720
     gtcgaaagtg tgcaggccag tttggggcaa acggtcaaga agggacaggt gctcgccgtt       780
     atcgccagcc ctgccgcatc cgagcagcgc agcgagttgc agacggcgca aaagcggctg       840
     gccttggccc agacaacttt tgaacgcgag aagcggctgt gggaacagaa gatttccgcc       900
     gagcaggact acctgcaagc cggccaggca ctgaacgagg cgcaggtcgc cgtggccaac       960
     gcgcagcaga agctgtcggc cgtgggcttg gccccagggt cttcgggcgg gctgaaccgc      1020
     ttcgagctgc gtgcgccttt cgatggcgtg gtgattgaaa agcacctcag cttgggtgag      1080
     gctgtcaagg aagacgccgc cgtgttcacg gtgtccgacc tgggccaggt ctgggcagag      1140
     attaacgtgc ccgccaagga cttgccgctg gtcagagtgg gtgagaaggt cagcatcaaa      1200
     gccacggcat tcgatgccag cgcacaaggg accatcactt tcgtgggtgc gctgatcggc      1260
     gaacaaaccc gcatggccaa ggctcgtgtg gtcttggcca atccccaggg cgcgtggcgt      1320
     cccggcctgt tcgtcaatgt ggaagtgatc gcgtccgaaa ccgccgtgcc agtcagtgtg      1380
     gctagcgacg ctattcagag cgtgggggac aagccggtcg ttttcgtcaa ggtgaaagac      1440
     ggctttgtag cccagcctgt gcagttgggt cgcagcgatg gcaaacgggt cgaggtactg      1500
     caaggtcttc aagcaggggc ggcatatgcg gccgcaggca gtttcgtcgt gaagtctgaa      1560
     ctcggcaaag cctctgccga gcacacccat tga                                   1593
//

If you have problems or comments...

PBIL Back to PBIL home page