(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE220

ALDEN1_2.PE220       Location/Qualifiers
FT   CDS_pept        complement(251578..252903)
FT                   /locus_tag="Alide_0224"
FT                   /gene_family="HOG000144619" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02321"
FT                   /codon_start="1"
FT                   /product="outer membrane efflux protein"
FT                   /transl_table="11"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   ajs:Ajs_1847 outer membrane efflux protein"
FT                   /db_xref="GI:319760958"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="GeneID:10102247"
FT                   /translation="MLKSIHNRRASAVAAGLVFVLTAGTASAQALPAVPGHSRSANGGE
FT                   QIEAATPLSLQEAIALALEGNLDLTVAQREIEAVEGQVIQGRVRPNPELAYSLEDQRTP
FT                   TRTQSVQINLPIELGGKRAARIAAAERGRDVAVEELNMRRVEIRAAVVSAFFEALAAQD
FT                   RTMLAQDSVDLAKKATDAVAKRVTAGKVSPVEETKARVAEAGVRVELAQAQSEQRSTRA
FT                   RLAGLLGANPPRFTQVAGSVDDLPAVPSLDDIQQRLSASSALRRAQLEVERRRSLADVE
FT                   RSKQTPDVTVSLGVKRPNELARNQLMLGVSVPLPLFDRNQGNLLEALKREDKARDELQA
FT                   LNLRLSTEVLQARERLTLVRGEIDVLQREVLPGAKSAYDAATVGFGYGKFNFLEVLDAQ
FT                   RTYFAAQSQYLKALAEAHRAAADMDRVIGASEPTITPPANKE"
FT                   /protein_id="YP_004124895.1"
     atgttgaaga gtattcacaa tcgcagggcg agcgcggtcg cggcaggctt ggtctttgtg        60
     ctcacggcgg ggacggcttc cgcccaggca ctgccggcgg tgcctggcca ttcgcggagc       120
     gccaacggcg gggagcagat tgaagcggcg acgcctctga gcctgcaaga ggccatcgcg       180
     ctggctttgg aggggaatct tgacctgacc gtcgcccaac gggaaatcga ggccgtggaa       240
     ggccaggtaa ttcagggacg agtacgtccc aatcccgaac tggcgtactc gctcgaagac       300
     caacgcacgc caacccgcac gcaaagcgtc cagatcaatc tacccatcga actggggggc       360
     aagcgcgctg cccgcattgc cgcggcagag cgggggcgtg acgtcgcagt tgaagaactg       420
     aacatgcggc gtgtcgaaat tcgcgccgca gtggtctccg cctttttcga ggcgttggct       480
     gcccaggatc gcaccatgct ggctcaggac agcgtcgatc tggccaagaa agcgacggat       540
     gcagtcgcaa agcgcgtgac ggcgggcaag gtgtccccag tcgaggagac caaggctcgg       600
     gtggccgaag ctggcgtgcg agttgaactg gcgcaggctc agagcgagca acgcagcacc       660
     cgcgcacggc tggcgggttt gctgggagcc aatccaccgc gattcaccca ggtggcaggc       720
     agtgtggacg atcttccggc cgtcccttcg ctggatgaca tccagcagcg cctgtcggcc       780
     tcatcggcac tgcgccgggc gcagttggag gtcgaacgcc gccggtcgct ggccgacgtg       840
     gagcgcagca agcagacgcc cgacgtcacg gtcagcctgg gcgtgaagcg cccgaacgag       900
     cttgcgcgca atcagttgat gctcggcgtt tccgtgccgc tgcctttgtt tgaccgcaat       960
     cagggcaact tgctggaggc gttgaagcgt gaggacaagg cgcgggacga actccaggcg      1020
     ttgaacctgc gcctgagcac ggaagtgctg caagcccgcg aacggctgac gttggttcgc      1080
     ggcgagatcg acgtgttgca gcgcgaggta ctgcctgggg ccaagagcgc ctatgacgcg      1140
     gccaccgtgg gttttggcta cgggaagttc aatttcctgg aagtgctgga cgcacagcgc      1200
     acctacttcg ccgcccagtc ccaatatctc aaggcgctgg ccgaagcgca tcgtgcggcg      1260
     gcggacatgg atcgcgtgat cggcgcatcc gaacccacga tcaccccgcc tgcaaataag      1320
     gaatga                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page