(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE224

ALDEN1_2.PE224       Location/Qualifiers
FT   CDS_pept        254925..256115
FT                   /locus_tag="Alide_0228"
FT                   /gene_family="HOG000126763" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01386"
FT                   /codon_start="1"
FT                   /product="heavy metal sensor kinase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: heavy metal sensor kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; histidine kinase HAMP region domain
FT                   protein; KEGG: dia:Dtpsy_2216 heavy metal sensor signal
FT                   transduction histidine kinase; SMART: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein"
FT                   /db_xref="GI:319760962"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0004673"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="GeneID:10102251"
FT                   /translation="MDTLRQQQTQVNHLIAEAAELDSGTLAHKLDDGMVGRQDMKLILT
FT                   RADGSVIYASAGIPVHHRVIDMRFEATTGIPPIQAVLSLDVSEDDRVLERLARTLVAAA
FT                   LAGAVVIAAGGFTLVQIGLRPVRDLSAQIQALEADTLHRLLDGSAQPDELAPLVAHVNE
FT                   LLKRLHKAYEQLEAFNADVAHELFTPLATLMGGTEVALRKARDADTLRDVLGSHLEDLQ
FT                   RMSMIVQDMLFLSQADRGAEARREHVASMAGVARTVVELHEAAIEEAGLKVRINGDATG
FT                   LADVRLLQRALSNLIGNATRHAHPHSTVVVQIDRLDGEIALRVVNEGQTISAEHLPNLF
FT                   NRFYRADAARSDAARNHGLGLAIVAAIARMHGGRTMVDSSNGITSIGLMVPTPRAQ"
FT                   /protein_id="YP_004124899.1"
     ATGGACACGC TGCGGCAACA GCAGACCCAG GTGAACCATC TTATTGCCGA GGCAGCAGAG        60
     TTAGACAGCG GCACGCTCGC ACACAAGCTC GACGATGGCA TGGTCGGCCG ACAGGACATG       120
     AAATTGATCC TGACCCGTGC CGACGGCAGC GTCATCTATG CCAGCGCCGG CATTCCAGTG       180
     CATCACCGCG TGATCGACAT GCGATTCGAG GCTACGACCG GCATCCCCCC CATCCAGGCG       240
     GTGCTGAGTC TTGATGTCAG CGAGGACGAT CGTGTGCTAG AACGCCTAGC CCGCACGCTC       300
     GTCGCCGCCG CACTCGCTGG CGCAGTGGTG ATTGCTGCTG GCGGATTTAC GCTGGTGCAA       360
     ATCGGGCTGC GTCCCGTGCG CGACCTCTCG GCTCAGATCC AGGCACTGGA GGCCGATACT       420
     CTGCACCGGC TTCTGGATGG CTCCGCTCAA CCCGACGAAC TGGCTCCGCT GGTGGCTCAC       480
     GTCAACGAGT TGCTGAAGCG TCTGCACAAA GCCTACGAAC AACTGGAAGC CTTCAATGCT       540
     GACGTTGCGC ATGAACTGTT CACGCCGTTG GCGACGTTGA TGGGGGGCAC TGAAGTTGCT       600
     TTGCGCAAAG CACGCGATGC CGACACGTTG CGAGACGTGT TGGGCTCGCA CCTCGAAGAT       660
     CTCCAGCGCA TGTCGATGAT CGTGCAGGAC ATGCTCTTTC TGTCGCAAGC CGACCGTGGG       720
     GCTGAGGCCC GCCGCGAGCA CGTCGCCAGC ATGGCAGGCG TTGCGCGCAC GGTGGTGGAA       780
     TTGCACGAGG CAGCCATTGA GGAAGCCGGG CTGAAAGTTC GTATCAATGG TGATGCCACT       840
     GGCTTGGCCG ACGTGCGCCT ATTGCAGCGC GCATTGTCAA ACCTGATCGG CAACGCAACC       900
     CGGCACGCGC ATCCGCACAG CACCGTTGTC GTGCAAATCG ACCGGCTGGA CGGCGAGATC       960
     GCCCTGCGGG TGGTGAACGA GGGGCAGACG ATTTCAGCCG AGCATTTGCC CAATCTGTTC      1020
     AACCGCTTCT ACCGGGCAGA TGCAGCGCGG TCGGATGCCG CCCGCAATCA TGGACTGGGC      1080
     TTGGCCATCG TGGCTGCCAT CGCCCGCATG CACGGAGGGC GGACGATGGT CGATTCGAGC      1140
     AACGGCATCA CGTCTATCGG GCTCATGGTG CCCACCCCGC GCGCGCAATA G               1191
//

If you have problems or comments...

PBIL Back to PBIL home page