(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE226

ALDEN1_2.PE226       Location/Qualifiers
FT   CDS_pept        complement(256847..257137)
FT                   /locus_tag="Alide_0230"
FT                   /gene_family="HOG000011608" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Sfri_3475"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="manually curated; KEGG: sfr:Sfri_3475 hypothetical
FT                   protein"
FT                   /db_xref="GI:319760964"
FT                   /db_xref="GeneID:10102253"
FT                   /translation="MGILDRIFGGHGGGHGSSHGHGNSRGHGSPSSHDWGHNPAPSVSG
FT                   ITCPQCKAINPNGARFCGQCGTSLVPASCTKCSSVIPIGAKFCAQCGNAVT"
FT                   /protein_id="YP_004124901.1"
     atgggaattc tggatcgaat ttttggcggg catggcgggg ggcatggcag ttcccacggg        60
     catggcaata gccgcggcca cggtagcccc agcagccacg actgggggca caatccagcg       120
     ccttcggtca gtggcatcac ctgcccgcaa tgcaaagcga tcaatccgaa cggcgctcgc       180
     ttttgcggcc agtgcgggac atcgctggtg ccagcgtcgt gcacgaagtg cagtagcgtc       240
     attccgatcg gcgcgaaatt ctgtgctcag tgcggcaacg cggtaactta a                291
//

If you have problems or comments...

PBIL Back to PBIL home page