(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE228

ALDEN1_2.PE228       Location/Qualifiers
FT   CDS_pept        259708..260163
FT                   /locus_tag="Alide_0232"
FT                   /gene_family="HOG000266084" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02047"
FT                   /codon_start="1"
FT                   /product="cd(ii)/pb(ii)-responsive transcriptional
FT                   regulator"
FT                   /transl_table="11"
FT                   /note="SMART: regulatory protein MerR; manually curated;
FT                   TIGRFAM: Cd(II)/Pb(II)-responsive transcriptional
FT                   regulator; KEGG: mpt:Mpe_A1657 transcriptional regulator;
FT                   PFAM: Transcription regulator MerR DNA binding; regulatory
FT                   protein MerR"
FT                   /db_xref="GI:319760966"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR011791"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="GeneID:10102255"
FT                   /translation="MKIGELAKAAHTQVETIRYYEREGLLPETARTDGNYRMYAEEHVD
FT                   RLSFIRHCRGLDMTLDEIRVLLRFKDAPHENCAQVNDLLDEHIDHVATRIKELKALERQ
FT                   LKTLRESCRESQQASQCGILTELSSASRQVHEPATRRGHVHGAHSLK"
FT                   /protein_id="YP_004124903.1"
     ATGAAAATCG GCGAACTGGC TAAGGCCGCA CATACCCAGG TAGAGACGAT CCGGTACTAC        60
     GAGCGTGAAG GCTTGCTACC AGAAACGGCC CGTACAGATG GCAACTACCG CATGTACGCA       120
     GAAGAACACG TTGACCGACT GTCCTTCATC CGGCACTGCC GGGGTTTGGA CATGACACTG       180
     GATGAAATCC GGGTTCTATT GCGCTTCAAG GATGCTCCGC ACGAGAACTG CGCCCAGGTG       240
     AATGACCTGC TCGACGAGCA CATCGACCAT GTGGCTACCC GCATCAAGGA ATTGAAAGCG       300
     TTGGAACGAC AGCTCAAGAC CTTGCGGGAA AGCTGCCGGG AATCCCAGCA GGCCAGCCAG       360
     TGCGGCATCT TGACCGAACT GTCCTCAGCA TCGCGCCAGG TGCACGAGCC AGCAACGCGC       420
     AGGGGTCATG TTCATGGGGC ACATAGCCTC AAGTGA                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page