(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE23

ALDEN1_2.PE23        Location/Qualifiers
FT   CDS_pept        complement(30135..31163)
FT                   /locus_tag="Alide_0023"
FT                   /gene_family="HOG000131661" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: bpt:Bpet3280 hypothetical protein"
FT                   /db_xref="GI:319760761"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="GeneID:10102046"
FT                   /translation="MDFALNEEQQMLQASARRFLADHHPLARARRALPWSDGAQQRLWK
FT                   EMAAMGWMALLLPEAHGGLELGLTEASLVAEEAGRQLLNLPWASSAVLLALWFKAAPND
FT                   APSVLRDAAQAATAGTRALHCVADTDAWWDHAGQCSDIVVVRGWHDGAAPLQIALVDAA
FT                   QVAAAPALDPTLRQGAAARMPLQWHTLDVPARQRMHARAAHRLMLAAELVGVGQAALDM
FT                   ASAHAKERVQFGKPIGSYQALKHQLANAWMGVDNARLAVLYATAALDGGLPDARFACAV
FT                   AEYTAIDGALQSTRTAIQVHGGMGFTWEHDAHLLLKRAQHLAARLGGASRALAQVETLT
FT                   LP"
FT                   /protein_id="YP_004124698.1"
     atggatttcg cattgaacga agagcagcag atgctgcagg catcggcccg ccgcttcctg        60
     gccgaccatc atccgctggc gcgcgcgcgc cgtgccctgc cctggagcga cggcgcgcag       120
     cagcggctgt ggaaggaaat ggcggccatg ggctggatgg ccctgctgct gcccgaagcg       180
     cacggcggcc tggaactggg gctgacagaa gccagtctgg tggccgagga agcgggccgc       240
     cagctgctga acctgccctg ggccagcagc gccgtgctgc tcgcgctgtg gttcaaagcc       300
     gcgcccaacg acgcgccctc cgtgctgcgc gacgcggcgc aggccgccac ggccggcacg       360
     cgcgccctgc actgcgtggc cgacaccgac gcctggtggg accatgcggg ccagtgcagc       420
     gacatcgtcg tggtgcgcgg ctggcacgat ggcgcggcgc cactgcagat cgccctggtg       480
     gacgccgcgc aagtggccgc tgcgccggcg ctggacccca cgctgcgcca gggcgccgca       540
     gcccggatgc cgctgcagtg gcacacgctg gacgttccgg cgcggcagcg catgcatgcc       600
     cgcgccgccc accggctgat gctggcggcc gagctggtgg gcgtaggtca agcggcgctc       660
     gacatggcca gcgcccatgc gaaggaacgc gtgcagttcg gaaaacccat cggcagttac       720
     caggccctca agcaccagct ggccaatgcc tggatgggcg tggacaacgc ccgcctggcc       780
     gtgctctacg ccacggccgc gctcgatggc ggtttgccgg acgcccgctt cgcctgcgcc       840
     gtggccgagt acacggccat cgacggcgcc ctgcagtcca cgcgcactgc catccaggtg       900
     cacggcggca tgggcttcac ctgggagcac gacgcgcacc tgctcctcaa gcgcgcgcag       960
     cacctggccg cgcgcctggg cggcgcctcg cgtgctcttg cgcaggtcga gacgctgacg      1020
     ctgccttga                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page