(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE231

ALDEN1_2.PE231       Location/Qualifiers
FT   CDS_pept        complement(262595..263194)
FT                   /locus_tag="Alide_0235"
FT                   /gene_family="HOG000289337" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF10502"
FT                   /codon_start="1"
FT                   /product="peptidase s26, conserved region protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Peptidase S26, conserved region; KEGG:
FT                   dia:Dtpsy_1292 TraF peptidase. Serine peptidase. MEROPS
FT                   family S26C"
FT                   /db_xref="GI:319760969"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="GeneID:10102258"
FT                   /translation="MTFPSAVAGAAGIPPRPRSRLRARIVLAGLSACGLAALAWASFVQ
FT                   PMPRLIYNPSDSVAVGWYRVDPLGHDTGSLPRPLSVGSIVLTTLPPDAAALAAQRGYLP
FT                   ARVPLLKRVGAVAPQEVCITGRVVRIDGVPSAAVLPADRWGRPLPSWQQCRHLEPGELF
FT                   LLSVTNPASFDSRYFGPVSTSAVIGVAHPVWLESRP"
FT                   /protein_id="YP_004124906.1"
     atgacgtttc catccgccgt tgccggtgca gcgggcattc cgccgcgtcc tcgctcgcgc        60
     ctgcgcgctc gtatcgtgct ggcgggcctg tccgcctgcg gcctcgctgc gctggcctgg       120
     gcgtccttcg tgcagccgat gccgcgcctg atctacaacc cgtccgacag tgtggcggtc       180
     ggctggtatc gcgtcgatcc gctgggccac gataccggct cgctgccacg tcctctgtcc       240
     gtgggcagca tcgtcctgac cacgctgccg ccagacgccg ccgcgctggc cgcgcagcgt       300
     ggctacctac cggcgcgcgt gccgctgctc aagcgcgtgg gcgccgtcgc gccgcaggag       360
     gtgtgcatca ctggccgcgt cgtccgcatc gacggcgtgc cttcggccgc cgtgctgcct       420
     gccgaccgct ggggccggcc gctgccatct tggcagcagt gccgtcacct agaacccggc       480
     gaactgttcc tgctcagtgt gaccaacccg gcgtcgttcg acagccggta tttcgggccg       540
     gtcagcacat ccgccgtgat cggcgtcgcg catccggtct ggctggagtc ccgcccatga       600
//

If you have problems or comments...

PBIL Back to PBIL home page