(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE232

ALDEN1_2.PE232       Location/Qualifiers
FT   CDS_pept        complement(263191..263736)
FT                   /locus_tag="Alide_0236"
FT                   /gene_family="HOG000289326" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_3522"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_3522 hypothetical protein"
FT                   /db_xref="GI:319760970"
FT                   /db_xref="GeneID:10102259"
FT                   /translation="MTASVSSAAAPVACAATAALAAPSGQPASAPLTRVALAYIEPRFK
FT                   LYLRFGEPARTLQLDRWRRCAVFLPGAMLCRIRWQANDYGTIRWQLMVMQACTPLDAAQ
FT                   RIPGVQPGARLLLHAEGENQVRAVLERIDAIEALGIAPNGASPAYWRTLANRLAARLPL
FT                   PEYTAERHAAWLTGRALS"
FT                   /protein_id="YP_004124907.1"
     atgactgcat ccgtttcgtc tgccgccgcg cctgttgcct gcgcggccac ggctgcgctc        60
     gcagcacctt ccggccagcc cgccagcgcg ccgctgacgc gcgtggcgct ggcctacatc       120
     gaaccgcgct tcaagctcta cctgcgcttc ggcgaacctg cgcgcacgct ccagctcgac       180
     cgctggcggc gctgcgcggt gttcctgccg ggcgccatgc tctgccgcat ccgctggcag       240
     gccaacgact acggcacgat ccgctggcag ctcatggtga tgcaggcttg cacgccgctc       300
     gatgcggcgc agcgcatccc cggcgtgcag ccgggcgcgc gcctgctgct acacgccgag       360
     ggcgagaacc aggtgcgcgc cgtgctggag cgcatcgacg ccatcgaggc gctgggcatc       420
     gcgcctaacg gcgcctcgcc cgcgtactgg cgcacgctcg ccaaccggct cgctgcgcgc       480
     ctgccgctgc ccgaatacac cgccgagcga catgctgcct ggctcaccgg gagggcgctg       540
     tcatga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page