(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE233

ALDEN1_2.PE233       Location/Qualifiers
FT   CDS_pept        complement(263733..264017)
FT                   /locus_tag="Alide_0237"
FT                   /gene_family="HOG000289305" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Aave_0688"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aav:Aave_0688 hypothetical protein"
FT                   /db_xref="GI:319760971"
FT                   /db_xref="GeneID:10102260"
FT                   /translation="MTAKPPPNGKRTAKRVSIGARPPANPHAEAWIRQGDADALGKGDL
FT                   YTARLTLDITPAMRARIKVSAFTQGVTVADLLRGLLEREFPEHRRENTP"
FT                   /protein_id="YP_004124908.1"
     atgaccgcga agccgccacc gaacggcaag cgcacggcaa agcgcgtcag catcggcgcg        60
     cgtccacccg cgaatccgca cgccgaggcg tggattcgcc agggcgatgc cgatgcgctg       120
     ggcaagggcg acctctacac ggctcgcttg accctcgaca tcacgcccgc gatgcgggcg       180
     cgcatcaagg tttcggcctt cacgcaaggc gtgaccgtcg ccgacctgct gcgcggcctg       240
     ctggagcggg agtttccaga gcaccgcagg gagaacaccc catga                       285
//

If you have problems or comments...

PBIL Back to PBIL home page