(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE234

ALDEN1_2.PE234       Location/Qualifiers
FT   CDS_pept        complement(264014..264652)
FT                   /locus_tag="Alide_0238"
FT                   /gene_family="HOG000019423" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Tgr7_1879"
FT                   /codon_start="1"
FT                   /product="cobyrinic acid ac-diamide synthase"
FT                   /transl_table="11"
FT                   /note="KEGG: tgr:Tgr7_1879 cobyrinic acid ac-diamide
FT                   synthase"
FT                   /db_xref="GI:319760972"
FT                   /db_xref="GeneID:10102261"
FT                   /translation="MIVALLNQKGGVGKTTLATHIAGELAMRGQHVVLLDADPQGSSLD
FT                   WTQRRSQQGLPRLFSAVGLARETLHQEAPELARRADHVVIDGPPRIAALARSALLAAER
FT                   VLIPVQPSPYDLWASAEMVALIREAQVFRPALRAAFVINRRVSTTVIGREARQALADQP
FT                   LPALRAEVHQRIVFADSVAAGRLARETAPDSAAAREITALVDELLRWTP"
FT                   /protein_id="YP_004124909.1"
     atgatcgtcg ctctgctcaa ccagaaaggc ggcgtgggca agaccacgct cgccacccac        60
     atcgccggcg agctggcgat gcgcgggcag cacgtcgtac tgctggacgc cgatccacaa       120
     ggctcatcgc tggactggac gcagcgcaga agccagcaag gcttgccacg gctgttcagc       180
     gccgtaggcc tcgcacgcga aacactgcat caggaagcgc cagaactcgc caggcgggcc       240
     gatcacgtcg tcatcgacgg cccgccgcgc atcgccgcct tggcgcgctc cgcgctgctg       300
     gcggccgagc gcgtgttgat ccccgtgcag cccagcccct acgacctgtg ggccagcgcc       360
     gagatggtgg cgctgatccg tgaggcgcag gtgttccggc ctgcgctgcg cgcggccttc       420
     gtcatcaacc ggcgcgtcag caccaccgtg atcgggcgcg aagcgcgcca ggcgctagcc       480
     gaccaaccgc ttcctgcgct gcgtgcggaa gtgcatcagc gcatcgtgtt cgccgacagc       540
     gtggccgctg gccggcttgc acgcgagacg gcgccggaca gcgccgccgc ccgcgaaatc       600
     accgcactgg tggacgaact gctgcggtgg acgccatga                              639
//

If you have problems or comments...

PBIL Back to PBIL home page