(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE235

ALDEN1_2.PE235       Location/Qualifiers
FT   CDS_pept        complement(264906..265739)
FT                   /locus_tag="Alide_0239"
FT                   /gene_family="HOG000289304" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF10134"
FT                   /codon_start="1"
FT                   /product="replication initiator protein a"
FT                   /transl_table="11"
FT                   /note="PFAM: Replication initiator protein A; KEGG:
FT                   dac:Daci_2721 replication initiator and transcription
FT                   repressor protein"
FT                   /db_xref="GI:319760973"
FT                   /db_xref="InterPro:IPR018777"
FT                   /db_xref="GeneID:10102262"
FT                   /translation="MSKPLQEREQLDLFRALPGDMAPRDSQDLMAFPFFSLAKSRRTAP
FT                   IDFRASNVTIRVEGTAEHGIATIWDADILIWAASQIVEARDAGLRPSRLMQVRPYEVLR
FT                   FIGRGTSLRDYQRLKAALDRLQSTTVATSIRETTGRRLHRFSWINEWKELADASGTPLG
FT                   LELILPDWFYAGVLDAALVLTIDPAYFRLTGGIERWLYRLVRKHGGRQPGGWQFDFQHL
FT                   YRKSGSVARYYDFAADLRALVARQALPGYLLGIEHVSGISSPLLTFRPVPQTARG"
FT                   /protein_id="YP_004124910.1"
     atgtccaaac ccttgcagga acgcgaacag ctcgacctgt tccgcgcgct gccgggcgac        60
     atggcgccac gcgacagcca ggatttgatg gcctttccgt tcttctcgct ggcgaagtcg       120
     cggcgcacgg cgccgatcga cttccgcgcg agcaacgtga ccatccgcgt ggaaggcaca       180
     gccgagcacg gcatcgccac gatctgggat gccgacatcc tgatctgggc cgccagccag       240
     atcgtggaag cgcgcgacgc gggcctgcgg ccctcgcgct tgatgcaggt acgcccctac       300
     gaggtgctgc gcttcatcgg gcgcggtacg tcgctgcgcg actaccagcg cctcaaggcc       360
     gcgctcgacc ggctgcaatc gaccacggta gccacgtcca tccgcgagac gaccggccgg       420
     cgcctgcacc gcttctcgtg gatcaacgaa tggaaggaac tggccgatgc cagcggcacg       480
     ccgctgggcc tcgaattgat cctgccggac tggttctatg cgggcgtgct ggatgccgcc       540
     ctggtgctga ccatcgaccc ggcgtatttc cggctgaccg gcggcatcga gcggtggctg       600
     taccgcttgg tgcgcaagca cggcggccga cagccgggcg gctggcaatt cgacttccag       660
     cacctgtacc gcaaatcggg cagcgtggcg cgctactacg acttcgccgc cgacctgcgg       720
     gcgctggtgg cgcggcaagc cttgccgggc tacctgttgg gcatcgagca cgtatccggg       780
     atttcctcgc cgctgctgac gttccggccc gtgccgcaga cggcacgggg ataa             834
//

If you have problems or comments...

PBIL Back to PBIL home page