(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE236

ALDEN1_2.PE236       Location/Qualifiers
FT   CDS_pept        complement(265766..266047)
FT                   /locus_tag="Alide_0240"
FT                   /gene_family="HOG000289292" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_2652"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_2652 hypothetical protein"
FT                   /db_xref="GI:319760974"
FT                   /db_xref="GeneID:10102263"
FT                   /translation="MRPAPLRPAATVSTAAAQPQRYLTNDEAAEYLRLSPRTLEKQRVI
FT                   GGGPRFRKFGRRVMYAVADLDAWAADRSFETTSDPEYAEHHSADSRAR"
FT                   /protein_id="YP_004124911.1"
     atgcgtcccg ctcccttgcg gcctgccgcc actgtctcga ccgctgccgc gcagccccaa        60
     cgctatctca ccaacgacga agccgccgag tacctgcgcc tgtcgccgcg cacgctggaa       120
     aagcagcgcg tgatcggcgg tggcccgcgc tttcgcaagt tcggccgccg cgtcatgtac       180
     gccgtggctg acctcgatgc ctgggccgcc gaccgcagct tcgagacgac ttccgatccc       240
     gaatacgccg agcaccactc ggccgacagt cgtgcgcgct ga                          282
//

If you have problems or comments...

PBIL Back to PBIL home page