(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE238

ALDEN1_2.PE238       Location/Qualifiers
FT   CDS_pept        complement(267233..267583)
FT                   /locus_tag="Alide_0242"
FT                   /gene_family="HOG000289270" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_3529"
FT                   /codon_start="1"
FT                   /product="lipoprotein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_3529 lipoprotein"
FT                   /db_xref="GI:319760976"
FT                   /db_xref="GeneID:10102265"
FT                   /translation="MNAPLVTDAQRAALLANGRRVAAAEPHDPLPVVRLFTPDAHAIWL
FT                   LASLDPADGDTAFGVMDVGIGMPELGHIKLSDLTSIVGPNKQPVMRDLYFQAVHPLSEY
FT                   LRLAQENGSIVD"
FT                   /protein_id="YP_004124913.1"
     atgaacgctc ccctcgtcac cgatgcgcag cgcgccgcgc tgctggcgaa cgggcggcgg        60
     gttgccgccg ctgaaccgca cgacccgttg ccggtcgtgc ggctgttcac tcccgacgcg       120
     cacgccatct ggctgctggc ctcgctagat cctgccgatg gcgatacggc gttcggcgtc       180
     atggacgtgg gcatcggtat gcccgagctg ggccatatca agctgtccga cctgacctcc       240
     atcgtcggcc cgaacaaaca gcccgtgatg cgggatttgt atttccaggc ggtgcacccg       300
     ctgtcggaat atctgcggct ggcgcaggaa aacggttcta tcgtcgattg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page