(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE239

ALDEN1_2.PE239       Location/Qualifiers
FT   CDS_pept        267842..268135
FT                   /locus_tag="Alide_0243"
FT                   /gene_family="HOG000225390" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /codon_start="1"
FT                   /product="helix-turn-helix domain protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_3530 transcriptional regulator, XRE
FT                   family; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="GI:319760977"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="GeneID:10102266"
FT                   /translation="MQKRSIQRGRPTGATTYDAELAQAFGAAVRALRTERGIAQESLAH
FT                   LAGIERSHMGKVERGEHMPTLAIIFKIAGALECSTAVLMSEAESQLAAAAQP"
FT                   /protein_id="YP_004124914.1"
     ATGCAGAAGC GATCCATCCA GCGCGGCCGG CCGACCGGCG CCACCACCTA CGATGCCGAG        60
     CTGGCGCAAG CCTTCGGCGC GGCGGTGCGT GCGCTGCGGA CGGAGCGCGG CATCGCGCAG       120
     GAGTCGCTGG CACACCTCGC CGGCATTGAG CGTTCGCACA TGGGCAAGGT CGAGCGCGGC       180
     GAGCACATGC CCACGCTGGC GATCATCTTC AAGATCGCCG GCGCGCTCGA ATGCAGCACG       240
     GCGGTGCTGA TGAGCGAGGC TGAAAGCCAG CTCGCAGCAG CGGCCCAGCC GTAG             294
//

If you have problems or comments...

PBIL Back to PBIL home page