(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE241

ALDEN1_2.PE241       Location/Qualifiers
FT   CDS_pept        269905..270819
FT                   /locus_tag="Alide_0245"
FT                   /gene_family="HOG000219404" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:RPC_3544"
FT                   /codon_start="1"
FT                   /product="phage associated protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rpc:RPC_3544 phage associated protein"
FT                   /db_xref="GI:319760979"
FT                   /db_xref="GeneID:10102268"
FT                   /translation="MTIRESGADSTWHRAKEIVEAQGNDAQFVNISQNIASKLAVAQAN
FT                   RTIPGGIVVVIEGTCGNPAKSFMCVIKAEPHGGFTKRQAGGHLTLEYIKELILTPQAKL
FT                   YKIGAFLRQDPAAATPQEPTTGWRAFLFDDLITQGNKLAAAQYFYESFLGLEFPSNSAF
FT                   QTKQFHALTKDFIRNANVDSEKKIDLLNALTTYLKTDQAATIQVDVFSQNYLGDAALQD
FT                   AYTAYMGQKSFPNTAIHKDLSEVQSQLRLRKLTFGHDIKLTAPADQFENYVRIESIDGD
FT                   ADEHGNVPKWTKITVRDHIRDQE"
FT                   /protein_id="YP_004124916.1"
     ATGACGATCC GAGAGTCCGG GGCCGACAGC ACTTGGCACA GAGCTAAAGA AATCGTCGAG        60
     GCGCAGGGCA ACGATGCCCA ATTCGTAAAC ATCTCCCAAA ACATTGCCAG CAAGTTGGCG       120
     GTTGCCCAGG CCAATCGCAC CATCCCTGGC GGCATCGTCG TGGTGATCGA AGGAACTTGC       180
     GGCAACCCCG CCAAGTCCTT CATGTGCGTC ATCAAAGCCG AGCCCCATGG GGGCTTCACC       240
     AAGCGGCAAG CGGGCGGGCA TTTGACCTTG GAATACATCA AGGAACTCAT CCTCACACCC       300
     CAGGCCAAGC TCTACAAGAT TGGAGCCTTC CTGCGACAAG ATCCCGCAGC AGCCACACCC       360
     CAGGAGCCCA CTACCGGCTG GAGAGCCTTT CTGTTTGATG ACCTGATTAC TCAGGGCAAC       420
     AAGCTCGCTG CTGCGCAGTA TTTTTATGAG TCTTTTCTGG GGTTGGAATT TCCATCCAAC       480
     AGTGCATTTC AGACCAAACA GTTCCACGCA CTGACCAAAG ATTTCATCCG CAATGCCAAT       540
     GTCGATTCGG AGAAAAAAAT CGACCTCTTG AATGCTCTAA CCACCTACTT GAAGACGGAT       600
     CAGGCCGCCA CGATTCAGGT GGACGTGTTC TCCCAAAATT ATCTGGGAGA CGCAGCTCTG       660
     CAAGATGCAT ACACGGCCTA TATGGGGCAA AAGAGTTTTC CCAATACGGC CATCCATAAG       720
     GATCTCTCTG AGGTTCAAAG CCAATTGCGG CTGCGGAAAC TCACATTCGG GCATGACATC       780
     AAGCTCACCG CTCCCGCAGA TCAATTCGAG AACTACGTGC GAATCGAGTC CATCGACGGT       840
     GATGCCGATG AGCACGGCAA CGTGCCCAAG TGGACCAAGA TCACGGTGCG CGACCACATC       900
     CGAGACCAAG AGTGA                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page