(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE242

ALDEN1_2.PE242       Location/Qualifiers
FT   CDS_pept        270960..271802
FT                   /locus_tag="Alide_0246"
FT                   /gene_family="HOG000219405" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04607"
FT                   /codon_start="1"
FT                   /product="rela/spot domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: RelA/SpoT domain protein; KEGG: rpc:RPC_3545
FT                   RelA/SpoT"
FT                   /db_xref="GI:319760980"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="GeneID:10102269"
FT                   /translation="MVPRLKGDTSLIDKALYRSKPYKNPYEDITDKVGMRYVVLLTTHI
FT                   NTFCSIIESRECEAFWSWSKDKDYEEERLAKPLEFSYQSVHYVLRSKAELSVDGVNLPE
FT                   GLACEVQIRTLLQHAHSELTHDTLYKPKTTAKPSIKRTVAKSMALIEATDEFFEQAMKD
FT                   LASASEPQRQLLDYLSTTYRKGTGLEPGQERSNQLVVDAFMEFLPQETSARIEEFLTAK
FT                   NYIFEKIKEQNGQRHFFNQPAVLLAYFLVEKMPAQTRENWPIDSDDLAKIFSDLGAAF"
FT                   /protein_id="YP_004124917.1"
     ATGGTGCCTC GCCTCAAAGG CGACACCAGC TTGATTGACA AGGCCCTGTA CCGCAGCAAG        60
     CCCTATAAGA ATCCGTATGA GGACATTACT GACAAGGTGG GCATGCGGTA CGTGGTACTG       120
     TTGACCACGC ACATCAATAC GTTCTGCTCG ATCATCGAAA GCCGTGAGTG CGAAGCATTC       180
     TGGTCATGGT CCAAGGACAA GGACTACGAA GAGGAGCGGT TGGCCAAGCC CTTGGAGTTC       240
     TCCTATCAAT CGGTTCACTA CGTACTGCGC TCCAAGGCGG AGCTGTCCGT CGATGGGGTG       300
     AATCTCCCCG AGGGCCTTGC GTGTGAAGTG CAAATCCGCA CGCTCTTGCA GCATGCTCAT       360
     AGCGAACTAA CCCACGACAC GCTCTACAAG CCCAAGACCA CTGCAAAACC CTCCATCAAG       420
     CGCACTGTTG CCAAGAGCAT GGCATTGATC GAAGCTACAG ACGAATTCTT CGAGCAAGCC       480
     ATGAAGGATC TCGCCAGCGC CAGCGAGCCA CAGCGGCAAC TCTTGGACTA CCTAAGTACG       540
     ACCTACAGGA AGGGCACCGG CCTAGAGCCT GGCCAGGAGC GATCCAATCA GCTTGTGGTC       600
     GATGCCTTCA TGGAGTTTCT GCCGCAGGAA ACCAGTGCTC GTATCGAGGA ATTCTTGACG       660
     GCCAAGAACT ACATTTTTGA AAAGATCAAA GAGCAAAACG GCCAGCGACA TTTCTTCAAT       720
     CAACCTGCTG TACTCCTGGC GTACTTCCTC GTCGAGAAAA TGCCTGCCCA GACCCGAGAG       780
     AATTGGCCTA TAGACTCGGA TGATCTGGCC AAAATATTCA GTGATTTGGG CGCCGCATTT       840
     TAA                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page