(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE244

ALDEN1_2.PE244       Location/Qualifiers
FT   CDS_pept        complement(272208..274262)
FT                   /locus_tag="Alide_0248"
FT                   /gene_family="HOG000222687" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02195"
FT                   /codon_start="1"
FT                   /product="parb domain protein nuclease"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_3534 ParB domain protein nuclease;
FT                   PFAM: ParB domain protein nuclease; SMART: ParB domain
FT                   protein nuclease"
FT                   /db_xref="GI:319760982"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="GeneID:10102271"
FT                   /translation="MNAITQTEARAVNTAAAIPLEAADPTKNLILVPLSRLVLRPTGRN
FT                   VRKTPRMSIPELAASIRRVGLLQNLIVIASADGEHYEVVAGGRRLAALKLLAKKHRISK
FT                   EWEVPCLLVADGTARTASLTENVQREAMHPADQFEAFAALVAEGRPIEDIAADFSVTPL
FT                   VVQRRLKLANVSPRLMADYRADAVSLDQLMALAITDDHAAQESAFYDAPTWQRHPSNLR
FT                   ERLTEREIDAYRHPLVRFVGLDVYEQAGGRVRRDLFAEGDAGVYLTDAALLERLVQDKL
FT                   AGIAAETKAEGWAWVDAAPAATYADLQAFQRAPRERREPNKREAQRIEKLQAKMQEVAE
FT                   AVDAAMDADDENKADALQEEGETLGEQLQALEDGLQDYSPNVKAAAGAIVTIDRNGEAI
FT                   IHRGLMREAEAKALRTLERLRQGFSGEDAENDDEGEDDEQPKTAAMPDRLAQRLSAHRT
FT                   AALQIEVARHPQVALAAVVHGMVQTVLQESRYGHDLPLGVGLKVQDRLEGMAPDWPESP
FT                   AAVALRELQQVAGEGLPEDSAALFAALLAKPQDELVRLLAVCVASTVDVVTPRATPHQP
FT                   GAELAQAVGLDMAAWWQPTAEGYFKHVSKAVILDAVGAFAPESVTRLAKLKKADIASEA
FT                   ERLADGKGWMPAIFKATGPQDVAQEAGPEQDAPEDAEAMADEPAEALAA"
FT                   /protein_id="YP_004124919.1"
     atgaacgcca tcacccaaac cgaagcccgc gccgtcaata ccgccgccgc tatcccgctg        60
     gaagccgccg acccgaccaa gaacctgatt ctggttccgc tgtcgcggct ggtgctgcgg       120
     cccacgggcc gcaacgtgcg caagaccccg cgcatgtcca ttcccgaact ggccgcatcc       180
     atccggcgtg tgggcctgtt gcaaaacctg atcgtgattg catccgccga tggcgagcat       240
     tacgaggtgg tcgccggtgg ccgtcgcctc gccgcgttga agctgctggc gaaaaagcac       300
     cgcatcagca aggaatggga agtgccttgc ctgctggtgg ccgatggcac ggcccgcacg       360
     gccagcctca ccgagaacgt gcagcgcgaa gccatgcacc cggcagacca gttcgaggcg       420
     ttcgccgcgc tggtggccga aggccgaccc atcgaggaca ttgcagcaga tttcagcgtc       480
     acgccgctgg tggtgcagcg ccgcttgaag ctggcgaacg tctcgccgcg cctgatggcc       540
     gactatcgcg ccgatgcggt gagccttgac cagttgatgg cccttgccat caccgacgac       600
     cacgccgcgc aggaaagcgc gttctacgat gcgccaacgt ggcaacgtca cccgtccaat       660
     ctgcgcgaac gcctgaccga gcgcgaaatc gacgcctacc ggcatccgct ggtgcgcttc       720
     gtcgggctgg atgtctacga acaggcgggc ggcagggttc gccgtgacct gttcgcggaa       780
     ggcgatgcgg gcgtgtatct gaccgatgcc gctttgctgg aacggctggt gcaggacaag       840
     ctggcgggca tcgccgccga gacaaaggcc gaaggctggg cctgggtgga tgcagcaccc       900
     gctgccacct atgccgacct gcaagctttc cagcgtgcgc cgagggagcg ccgcgagccg       960
     aacaagcgcg aggcacagcg catcgagaag ctgcaagcca agatgcagga agtcgccgaa      1020
     gcggtggatg ctgcgatgga cgccgatgac gagaacaagg ccgacgcctt gcaggaggaa      1080
     ggcgaaaccc tgggcgaaca gttgcaggcg ctggaggatg gcttgcagga ctacagcccg      1140
     aacgtgaagg ccgcagccgg tgccatcgtc accatcgacc gcaacggcga ggccatcatt      1200
     catcgcggcc tgatgcgcga ggccgaggcc aaggcgctgc gcacgctgga acggctgcgc      1260
     caagggttca gcggcgagga tgccgagaac gacgacgaag gcgaggacga cgagcagccc      1320
     aagaccgccg ccatgcccga ccggctggcg cagcgcctga gcgcgcaccg caccgccgca      1380
     ctgcaaatcg aagtcgcacg gcatccgcag gtggcgctgg ctgccgtggt gcatggcatg      1440
     gtgcagaccg tcttgcagga aagccgctac ggccacgatc tgccgctggg cgtgggcctc      1500
     aaagtgcaag accggctgga aggcatggcc ccggactggc cggaatcgcc cgccgccgtg      1560
     gcgctgcgcg aactgcaaca ggtggccggg gaagggttgc cggaggacag cgccgcactg      1620
     ttcgccgcgc tgctggcgaa gccgcaagac gaactggtgc ggctgctggc cgtgtgcgtg      1680
     gcttccacgg tggacgtggt gacgccacgt gccacgccgc accagcccgg cgcagaactg      1740
     gcgcaggccg tgggcctcga catggccgca tggtggcagc cgaccgcaga aggctacttc      1800
     aagcacgttt ccaaggccgt gattctggat gccgtgggcg cgtttgcacc ggaatccgtc      1860
     acccggctgg cgaagctcaa gaaggccgac attgccagcg aagccgagcg actggccgat      1920
     ggcaagggct ggatgcctgc gatcttcaag gccacaggcc cgcaggatgt ggcgcaggaa      1980
     gcaggcccgg agcaggacgc cccggaggat gccgaagcaa tggcggatga acccgccgag      2040
     gcgctagccg cttga                                                       2055
//

If you have problems or comments...

PBIL Back to PBIL home page