(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE245

ALDEN1_2.PE245       Location/Qualifiers
FT   CDS_pept        complement(274328..275155)
FT                   /locus_tag="Alide_0249"
FT                   /gene_family="HOG000222632" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_2944"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_2944 hypothetical protein"
FT                   /db_xref="GI:319760983"
FT                   /db_xref="GeneID:10102272"
FT                   /translation="MQLASRFASRSPSLRSDYPLSDDQIRSVAPSIFADAPHESRSERY
FT                   SYIPTAAVLTELRKEGFQPFMVTQTRVRDEGKREHTKHMLRLRHASQINGAEANEIVLL
FT                   NSHDGTSSYQMLAGMFRFVCSNGLVCGDTVADVRVPHKGDVAGSVIEGAFEVLSGFERV
FT                   KESRDLMRGITLDDGESEVFARAALALKYDDPDKPAPITESQILMPRRFDDRRPDLWSV
FT                   FNRTQENLTKGGLHGRSANGRRQQTRPVQGIDSDVRLNRALWMLADGLRQLKA"
FT                   /protein_id="YP_004124920.1"
     atgcaactcg catcccgttt cgcttcccgc tccccttcgc tgcgcagtga ttacccgctg        60
     tccgatgacc agattcgcag cgtggccccg tccatcttcg cggacgcccc gcatgagagc       120
     cgttccgaac ggtatagcta catcccgacc gctgccgtgc tgaccgagct tcgcaaagaa       180
     ggtttccagc ctttcatggt gacgcaaacc cgcgtgcgcg atgaaggcaa acgcgagcac       240
     acgaaacaca tgctgcgcct gcgccacgcc agccagatca acggcgcgga ggctaacgaa       300
     atcgtgctgc tgaactcgca tgacggcacc agcagctatc agatgctggc cggaatgttc       360
     cggttcgttt gcagcaatgg ccttgtatgc ggcgacaccg tggccgatgt gcgcgtgccc       420
     cacaaaggcg acgtggccgg ttccgtcatt gaaggcgctt tcgaggtgtt gagcggcttc       480
     gagcgggtga aggagtcgcg cgacttgatg cgcggcatca ccttggacga tggcgaatcc       540
     gaagtgttcg cccgtgctgc gctggcgttg aagtacgacg acccggacaa acccgcaccc       600
     atcaccgaat cgcaaatctt gatgccgcgc cggttcgacg accgccgccc ggacttgtgg       660
     agcgtgttca accgcacgca ggagaacttg accaaaggcg gattgcatgg ccgcagcgcc       720
     aacggacgcc gccagcaaac ccgacctgtg cagggcattg attccgatgt gcgcctcaat       780
     cgcgctctct ggatgctggc cgatggcctg cgccagttga aagcctga                    828
//

If you have problems or comments...

PBIL Back to PBIL home page