(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE247

ALDEN1_2.PE247       Location/Qualifiers
FT   CDS_pept        276459..276767
FT                   /locus_tag="Alide_0251"
FT                   /gene_family="HOG000225390" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /codon_start="1"
FT                   /product="helix-turn-helix domain protein"
FT                   /transl_table="11"
FT                   /note="manually curated; PFAM: helix-turn-helix domain
FT                   protein; KEGG: hse:Hsero_2904 XRE family transcription
FT                   regulator protein; SMART: helix-turn-helix domain protein"
FT                   /db_xref="GI:319760985"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="GeneID:10102274"
FT                   /translation="MNIGQAIQLARSKRKLSQAALAKRAGISVSYLSLLERGRRDPPLS
FT                   TLQRIAAALVMPVEILFFLGAEEGELGHLNRDLAGQLAITALELLNGPLPDQAEVSV"
FT                   /protein_id="YP_004124922.1"
     ATGAACATCG GACAGGCTAT TCAACTCGCT CGGTCCAAGC GCAAGCTCTC CCAAGCTGCG        60
     CTGGCGAAGC GGGCTGGTAT CTCAGTGTCC TATCTCTCGC TGCTTGAGCG TGGCCGACGC       120
     GACCCGCCTT TGTCCACTCT GCAACGGATT GCCGCTGCGC TCGTTATGCC GGTAGAGATT       180
     CTTTTCTTCT TGGGCGCGGA AGAAGGGGAA CTCGGACACT TGAATAGAGA CCTTGCTGGT       240
     CAACTGGCAA TCACCGCATT GGAGCTTCTG AATGGACCTC TACCCGATCA AGCCGAGGTA       300
     TCGGTCTAA                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page