(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE248

ALDEN1_2.PE248       Location/Qualifiers
FT   CDS_pept        276730..277758
FT                   /locus_tag="Alide_0252"
FT                   /gene_family="HOG000050991" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Rmet_1473"
FT                   /codon_start="1"
FT                   /product="retron reverse transcriptase"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_1473 retron reverse transcriptase"
FT                   /db_xref="GI:319760986"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="GeneID:10102275"
FT                   /translation="MDLYPIKPRYRSNPVKSIAALARGLRWDAQSLVELADRANGMWRT
FT                   VKPKPGSTRQTFDAMGQLKEIHQRLKLNVFSKVDFPEYLQGSLKGRDYVTNASIHKGKQ
FT                   ILICEDVKGFFPSVSAAFVEDVWCGFFRFSPDVAKLLTRLTTKDGYLPQGAITSSFLAN
FT                   LVMWRYEPWLHAKFAQRGITYSRYVDDMAMSSATHLDKETQTWIIAQVYGMLAQHGLKA
FT                   SRKKHEVFSASQPMIATKLTVNRKPSLSPKKQSKVRTRVRQLEIAATSGASTDELRELA
FT                   NKAAQQVGQLGRFHKTPAAKLKSRIAVVRDNLSPEALSVTTAPAKVRLDTVPLVTDARP
FT                   WE"
FT                   /protein_id="YP_004124923.1"
     ATGGACCTCT ACCCGATCAA GCCGAGGTAT CGGTCTAATC CCGTCAAGAG CATTGCTGCA        60
     CTGGCTCGCG GCCTACGCTG GGATGCGCAA TCACTGGTGG AACTGGCTGA TCGAGCCAAT       120
     GGCATGTGGC GCACCGTGAA GCCAAAGCCG GGATCTACCA GGCAGACATT TGACGCGATG       180
     GGGCAGCTCA AAGAGATCCA TCAGCGTTTA AAGCTCAATG TCTTCTCCAA GGTGGATTTT       240
     CCAGAATACT TGCAAGGTAG CTTGAAGGGA CGTGACTATG TCACAAACGC ATCTATTCAC       300
     AAGGGCAAGC AGATACTGAT CTGCGAAGAC GTGAAGGGAT TCTTCCCTTC TGTGAGCGCG       360
     GCTTTTGTTG AGGACGTGTG GTGTGGCTTC TTCAGATTCT CTCCTGACGT TGCCAAGCTT       420
     CTAACGAGGC TCACCACAAA GGATGGCTAT CTTCCCCAAG GGGCCATTAC GAGTTCATTT       480
     TTAGCGAATC TCGTGATGTG GCGGTACGAG CCCTGGCTAC ATGCAAAGTT CGCTCAGCGA       540
     GGCATCACCT ATTCCCGTTA TGTGGATGAC ATGGCAATGT CATCAGCGAC ACATTTGGAT       600
     AAGGAAACTC AGACTTGGAT CATTGCCCAA GTCTATGGAA TGCTTGCTCA GCACGGCTTG       660
     AAGGCGAGCC GTAAGAAACA TGAGGTTTTC TCGGCTTCGC AGCCGATGAT CGCGACGAAG       720
     CTGACTGTGA ACCGCAAACC GTCATTGAGT CCCAAAAAAC AGTCCAAAGT TCGGACGCGA       780
     GTTCGGCAAT TGGAGATCGC CGCCACGAGC GGCGCGAGCA CGGATGAACT CCGGGAGCTT       840
     GCGAACAAGG CCGCCCAACA GGTGGGTCAA CTTGGGCGCT TTCACAAGAC GCCAGCAGCA       900
     AAGCTCAAGA GTCGTATTGC AGTTGTTCGG GACAATTTGT CGCCAGAGGC TTTGTCCGTC       960
     ACAACGGCAC CTGCGAAGGT CAGGCTTGAC ACAGTTCCTC TCGTCACGGA TGCCCGGCCC      1020
     TGGGAATAG                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page