(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE249

ALDEN1_2.PE249       Location/Qualifiers
FT   CDS_pept        complement(277930..278247)
FT                   /locus_tag="Alide_0253"
FT                   /gene_family="HOG000139267" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_2957"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_2957 transcriptional regulator"
FT                   /db_xref="GI:319760987"
FT                   /db_xref="GeneID:10102276"
FT                   /translation="MRSRPHDDAMAELFRDDPALALEVINGILADGDQAELMAVLRQLA
FT                   QAVGGVQAVAEQAHLNPTQLYRTLSPKGNPALSSLSAILKAMGLRLAVQPLALPPSAHA
FT                   A"
FT                   /protein_id="YP_004124924.1"
     atgagaagca gaccccatga cgatgcgatg gccgagttgt tccgggatga cccggcgctc        60
     gcactcgaag tcatcaacgg catcctggcc gatggcgacc aggccgagct gatggccgtg       120
     ctgcgccaac tcgcgcaggc cgtgggcggc gtgcaggcgg tggccgagca ggcgcacctg       180
     aatccgactc agctttaccg cacgctgtcg cccaagggca atcctgcact cagcagcctg       240
     tcggccatcc tcaaggcgat gggcctgcgc ttggcggtgc agcccctggc cttgccgccg       300
     tccgcgcacg cggcttga                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page