(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE25

ALDEN1_2.PE25        Location/Qualifiers
FT   CDS_pept        complement(32402..33367)
FT                   /locus_tag="Alide_0025"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bpet3282"
FT                   /codon_start="1"
FT                   /product="secreted protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpt:Bpet3282 secreted protein"
FT                   /db_xref="GI:319760763"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102048"
FT                   /translation="MIKQLMAGIALAAAALCGPAQAQNYPSKPVTIVVPFAPGGATDIM
FT                   ARTLAERLNKRLGQPVIVENKPGAGTMIASEHVARAQPDGHTVLLAASSLGIAPALYAK
FT                   VNYDPVKDFTPISLVASVVHVLQVHPSIPVKNVAELIAWVKANPGKANYGSVGAGTSTH
FT                   LESELFNTMAGVKMTHVPYKGSAPALMDLVGGNLQVMFDAWASSGPFVKDGKTRLLAVT
FT                   TAQRSKLLPDVPTVAESGLPGYEAMPWLGFVAPAGTPAAAVNRFHAELMEVLKEPEVQD
FT                   KFRALGLDIIGNTPQQFADFIKRDIVKWAKVVKDSGAKAD"
FT                   /protein_id="YP_004124700.1"
     atgatcaagc aactgatggc gggcatcgcc ctcgccgccg cggccctgtg cggccctgcc        60
     caggcccaga actaccccag caagcccgtc accatcgtcg tgccgttcgc gcccggtggt       120
     gccaccgaca tcatggcgcg caccctggcc gagcgcctga acaagcgact gggccagccc       180
     gtgatcgtgg agaacaagcc cggcgccggc accatgatcg cctccgagca tgtggccagg       240
     gcgcagcccg acggccacac cgtgctgctg gccgcctcct cgctgggcat tgcgccggcg       300
     ctctacgcca aggtcaacta cgaccccgtc aaggacttca cgccgatctc gctggtcgcc       360
     tccgtggtcc acgtgctgca ggtgcacccc agcatccccg tcaagaacgt ggccgagctc       420
     atcgcctggg tcaaggccaa ccccggcaag gccaactacg gctcggtggg tgcgggcacc       480
     tcgacccatc tggagtccga gctgttcaac accatggccg gcgtgaagat gacccatgtg       540
     ccctacaagg gcagcgctcc ggccctgatg gacctggtgg gcggcaacct gcaggtcatg       600
     tttgacgcct gggcctcttc cggcccgttc gtcaaggacg gcaagacgcg cctgctggcc       660
     gtgaccacgg cccagcgctc caagctgctg cccgacgtgc ccaccgtcgc cgaatccggc       720
     ctgcccggct acgaggccat gccctggctg ggcttcgtgg cgcccgcagg cacgcctgcc       780
     gccgcggtga acaggttcca tgccgagctg atggaagtgc tcaaggagcc cgaggtgcag       840
     gacaaattcc gcgcgctggg cctggacatc atcggcaaca cgccgcagca gttcgccgac       900
     ttcatcaagc gggacatcgt caagtgggcc aaggtggtca aggattcggg cgccaaggcg       960
     gattga                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page