(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE251

ALDEN1_2.PE251       Location/Qualifiers
FT   CDS_pept        complement(278679..280043)
FT                   /locus_tag="Alide_0255"
FT                   /gene_family="HOG000289180" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /codon_start="1"
FT                   /product="integrase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: integrase family protein; KEGG: ajs:Ajs_2959
FT                   phage integrase family protein"
FT                   /db_xref="GI:319760989"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="GeneID:10102278"
FT                   /translation="MAKIKLTKSAVDTAEVTGKDYELRDTIVPGFLCKVTAHGRKVFML
FT                   QYRTNWGERRKPKIGQFGELTVEQARSIAQDWLADVRKGDDPSAAKLAARMAPTVKELC
FT                   EQFIEEYSRPRNKPRTVDSYQGYIDRHILPALGKLKVPDVTRAHITTLMKDKARIGVTA
FT                   NRVLACLRKMFNMAEVWGYRPDGSNPCRHVPKYREDGETRYINNEELARLYAYLDRADA
FT                   QGLEHPTVTLAVRLQFEFSARMTEIRTLEWAWVDFENRRVVWPDSKTGDMSKPMSEAAY
FT                   QLLRNAPRIDDSPYVCPAIFDAKKPLPDSTYYNGWKRILGRAEVAHVGTHGIRHRAATD
FT                   IANSGIPIKVGMALTAHKTVTQFMAYVHAEDDPVRAAAEKVATLRRGAIDGQAQAAPTP
FT                   TAPASVLAVADGEKTRTSQGNYRPYRHRKSPTRAVPPGTKRAGSPSTKAPETAIA"
FT                   /protein_id="YP_004124926.1"
     atggccaaga tcaaactcac caaatccgct gtcgatacgg cagaagtcac cggcaaggac        60
     tacgaactgc gggacaccat tgtccccggc tttctctgca aagtcaccgc ccacggccgc       120
     aaggtcttca tgctccagta ccgcacgaac tggggcgagc gccgcaagcc gaagatcggc       180
     cagttcggcg aactgaccgt cgagcaggcg cggtcgatcg cacaggactg gctggccgac       240
     gtgcgcaagg gcgacgaccc cagcgctgcc aagctggccg cgcgcatggc ccctacggtc       300
     aaggagttgt gcgaacagtt catcgaggaa tactccaggc cgcgcaacaa gccccggacg       360
     gtcgattcct accagggcta catcgaccgc cacatcctgc ctgccctggg caagctcaag       420
     gtgccggacg taacgcgggc gcacatcacc acgctgatga aggacaaggc gaggatcggc       480
     gtcacggcca atcgggttct ggcctgtctg cgcaagatgt tcaacatggc cgaggtgtgg       540
     ggctaccggc ctgacggctc caatccgtgc cgtcacgtcc ccaagtaccg cgaggacggc       600
     gagacgcggt acatcaacaa cgaggaactg gcgcgactct atgcgtacct cgaccgtgcg       660
     gatgcccagg ggctggagca tccgaccgtg acactggcgg ttcgcctgca attcgagttt       720
     tccgcgcgga tgaccgaaat ccgcacgctc gaatgggctt gggttgattt cgagaatcgc       780
     cgagtcgtct ggcctgacag caagacgggc gatatgtcca agccgatgag cgaggcggcg       840
     taccagttgc tgcgcaatgc gcctcgcatc gacgactcgc cttacgtgtg tccggccatc       900
     ttcgatgcca agaagccatt gcccgacagc acgtactaca acggctggaa gcgcatcctg       960
     ggccgcgcag aggtagcgca tgtcgggacg cacggcatcc gccatcgcgc ggcgaccgac      1020
     attgccaact ccggtattcc catcaaggtc ggcatggcgc tgactgcgca caagaccgtc      1080
     acgcagttca tggcgtatgt ccatgcagag gatgacccgg tgcgggccgc tgccgagaag      1140
     gtggccaccc tgcgccgggg cgccatcgac ggccaggccc aggctgcgcc gacaccaacg      1200
     gcgcccgcct cggttctggc ggtcgcggat ggcgaaaaga cccgtacgag ccagggcaac      1260
     tatcgcccgt atcgccatcg caagagtcca acgcgcgctg tgccgcccgg cacgaagcgg      1320
     gccggatcgc cgtcaacgaa ggcgccggaa acggccatcg cgtga                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page