(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE253

ALDEN1_2.PE253       Location/Qualifiers
FT   CDS_pept        284700..285599
FT                   /locus_tag="Alide_0257"
FT                   /gene_family="HOG000163049" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03631"
FT                   /codon_start="1"
FT                   /product="ribonuclease bn"
FT                   /transl_table="11"
FT                   /note="PFAM: ribonuclease BN; KEGG: ajs:Ajs_0151
FT                   ribonuclease BN"
FT                   /db_xref="GI:319760991"
FT                   /db_xref="GO:0004540"
FT                   /db_xref="InterPro:IPR004664"
FT                   /db_xref="GeneID:10102280"
FT                   /translation="MQNLNQGARRLMQPAAPLLRAVQLWLDAEGLRMSAAMSFYGMLSL
FT                   APLLLLLVGVLGWWVDKAYLESSLVAQVQGVMGERGAEVVRMALASAKAPAQGWLASIA
FT                   GFVLLLSGATGVFAELQSALARLWVHGRAAPERKPWWHMASLRLRGLAYVLAIGFLLLI
FT                   SLVLSTAIKVLATWAGALLPFGAGVLLQFVNEAVAFAVAVLLFVGLMRIGSGPKPPLSC
FT                   LVLGAAVGAALFTAGKQLLAWYLSTAAVVSAYGAAGSLVVLLMWIYFSSAVLLFGASCA
FT                   RALDEARTAAGAQPVGQG"
FT                   /protein_id="YP_004124928.1"
     ATGCAGAACC TGAACCAGGG CGCCCGGCGC CTGATGCAGC CTGCGGCGCC GCTGCTGCGC        60
     GCCGTGCAGC TGTGGCTGGA CGCGGAGGGC CTGCGCATGA GCGCCGCCAT GTCGTTCTAC       120
     GGCATGCTGA GCCTGGCGCC GCTGTTGCTC CTGCTGGTGG GCGTGCTGGG CTGGTGGGTC       180
     GACAAGGCCT ATCTGGAGAG CAGCCTCGTC GCCCAGGTGC AGGGCGTGAT GGGCGAGCGC       240
     GGCGCCGAGG TGGTGCGCAT GGCGCTGGCC AGCGCCAAGG CGCCGGCGCA GGGCTGGCTG       300
     GCCTCCATCG CGGGCTTCGT GCTGCTGCTG TCGGGCGCCA CGGGCGTGTT CGCGGAGCTG       360
     CAGTCGGCGC TCGCGCGGCT GTGGGTCCAT GGCCGGGCCG CGCCCGAGCG CAAGCCATGG       420
     TGGCACATGG CGTCGCTGCG GCTGCGCGGG CTGGCCTATG TGCTGGCCAT CGGCTTCCTG       480
     CTGCTGATCT CGCTGGTGCT GTCTACGGCC ATCAAGGTGC TGGCCACCTG GGCCGGCGCC       540
     CTGCTGCCCT TCGGCGCCGG CGTGCTGCTG CAGTTCGTCA ACGAGGCCGT GGCCTTTGCC       600
     GTGGCCGTGC TGCTGTTCGT GGGGCTGATG CGCATCGGCA GCGGCCCCAA GCCGCCGCTG       660
     TCCTGTCTGG TGCTCGGCGC CGCCGTGGGC GCGGCGTTGT TCACCGCGGG CAAGCAGCTG       720
     CTGGCGTGGT ACCTGTCCAC GGCGGCCGTG GTCTCGGCCT ATGGGGCGGC GGGCTCGCTG       780
     GTGGTGCTGC TGATGTGGAT CTATTTCTCG TCGGCCGTGC TGCTGTTCGG CGCCAGCTGC       840
     GCACGGGCCC TCGACGAGGC GCGCACGGCC GCCGGCGCGC AGCCGGTGGG GCAGGGCTGA       900
//

If you have problems or comments...

PBIL Back to PBIL home page