(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE254

ALDEN1_2.PE254       Location/Qualifiers
FT   CDS_pept        285725..286441
FT                   /locus_tag="Alide_0258"
FT                   /gene_family="HOG000220583" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_0152"
FT                   /codon_start="1"
FT                   /product="17 kda surface antigen"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0152 17 kDa surface antigen"
FT                   /db_xref="GI:319760992"
FT                   /db_xref="GeneID:10102281"
FT                   /translation="MNPATSSQPAASVKWLWAAVGALGVSVLALGGTLLAQNLRGDASP
FT                   AAQATAAALRTPESEIIDEKAPQGQAQQALAATDSRAVQSRRAPMPQADSYLQPAAQSR
FT                   PAAPVCASCGRVESVQAIEQAAPATGLGAVAGGVLGGVLGNQIGKGSGRTAATVLGAVG
FT                   GGYVGHKVEERTRTTTVYQMRVRMQDGSVRSFTRSQPVAEGTPVRVQGKGFRVDDGSGD
FT                   ADRAGTQPVRVVDRGY"
FT                   /protein_id="YP_004124929.1"
     ATGAACCCCG CCACCTCCTC CCAGCCTGCG GCCAGCGTCA AATGGCTCTG GGCCGCCGTG        60
     GGCGCGCTCG GCGTGAGCGT GCTGGCCCTG GGCGGCACGC TGCTGGCGCA GAACCTGCGC       120
     GGCGACGCCT CGCCCGCGGC GCAGGCCACG GCCGCCGCGC TGCGCACGCC CGAATCCGAG       180
     ATCATCGATG AAAAAGCGCC TCAAGGGCAG GCGCAGCAAG CACTGGCAGC TACTGATTCA       240
     AGAGCGGTCC AGTCCCGGCG CGCTCCGATG CCCCAGGCCG ACTCTTACCT GCAGCCGGCC       300
     GCCCAGAGCC GACCCGCGGC GCCGGTCTGC GCCAGCTGCG GGCGCGTGGA GTCGGTGCAG       360
     GCCATCGAGC AGGCGGCGCC CGCGACGGGC CTGGGCGCGG TGGCCGGTGG CGTGCTCGGC       420
     GGCGTGCTGG GCAACCAGAT CGGCAAGGGC TCGGGCCGCA CGGCTGCCAC GGTGCTGGGC       480
     GCCGTGGGCG GAGGCTACGT GGGCCACAAG GTGGAGGAGC GCACCCGCAC CACCACCGTC       540
     TACCAGATGC GCGTGCGCAT GCAGGACGGT TCGGTGCGCA GCTTCACGCG TTCCCAGCCC       600
     GTGGCCGAGG GCACGCCCGT GCGCGTGCAG GGCAAGGGCT TTCGCGTGGA CGACGGCAGC       660
     GGCGACGCGG ACCGCGCCGG CACGCAGCCC GTGCGCGTGG TGGACAGGGG GTATTGA          717
//

If you have problems or comments...

PBIL Back to PBIL home page